Rabbit STAU1 Polyclonal Antibody | anti-STAU1 antibody

STAU1 antibody - N-terminal region

Cat. Num. AAA3205307

• Gene Names: STAU1; STAU; PPP1R150
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
• Applications: Immunohistochemistry, Western Blot
• Purity: Protein A purified
• Synonyms: STAU1; Polyclonal Antibody; STAU1 antibody - N-terminal region; anti-STAU1 antibody

• Host: Rabbit
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
• Clonality: Polyclonal
• Purity/Purification: Protein A purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: LSVGGQQFNGKGKTRQAAKHDAAAKALRILQNEPLPERLEVNGRESEEEN
• Sequence Length: 577

• Applicable Applications for anti-STAU1 antibody: Immunohistochemistry (IHC), Western Blot (WB)
• Homology: Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 100%
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human STAU1
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-STAU1 AntibodyParaffin Embedded Tissue: Human IntestineCellular Data: Epithelial cells of intestinal villasAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Western Blot (WB)

(Host: RabbitTarget Name: STAU1Sample Type: HepG2Lane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 2.5ug/mLPeptide Concentration: 2.0ug/mLLysate Quantity: 25ug/laneGel Concentration: 12%STAU1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

Western Blot (WB)

(WB Suggested Anti-STAU1 Antibody Titration: 1.25ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)

Related Product Information for anti-STAU1 antibody

This is a rabbit polyclonal antibody against STAU1. It was validated on Western Blot and immunohistochemistry

Target Description: STAU1(Staufen) is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind RNAs having double-stranded secondary structures. The human homologue of staufen encoded by STAU, in addition contains a microtubule- binding domain similar to that of microtubule-associated protein 1B, and binds tubulin. Staufen is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind RNAs having double-stranded secondary structures. The human homologue of staufen encoded by STAU, in addition contains a microtubule- binding domain similar to that of microtubule-associated protein 1B, and binds tubulin. The STAU gene product has been shown to be present in the cytoplasm in association with the rough endoplasmic reticulum (RER), implicating this protein in the transport of mRNA via the microtubule network to the RER, the site of translation. Five transcript variants resulting from alternative splicing of STAU gene and encoding three isoforms have been described. Three of these variants encode the same isoform, however, differ in their 5'UTR.

Product Categories/Family for anti-STAU1 antibody

Polyclonal; RNA Binding Proteins; DNA/RNA/Protein Interactions; Immunohistochemistry

NCBI and Uniprot Product Information

• NCBI GI #: 90185286
• NCBI GeneID: 6780
• NCBI Accession #: NP_059347
• NCBI GenBank Nucleotide #: NM_017453
• UniProt Accession #: O95793
• Molecular Weight: 63kDa
• NCBI Official Full Name: Double-stranded RNA-binding protein Staufen homolog 1
• NCBI Official Synonym Full Names: staufen double-stranded RNA binding protein 1
• NCBI Official Symbol: STAU1
• NCBI Official Synonym Symbols: STAU; PPP1R150
• NCBI Protein Information: double-stranded RNA-binding protein Staufen homolog 1
• UniProt Protein Name: Double-stranded RNA-binding protein Staufen homolog 1
• Protein Family: Double-stranded RNA-binding protein
• UniProt Gene Name: STAU1
• UniProt Synonym Gene Names: STAU
• UniProt Entry Name: STAU1_HUMAN

NCBI Description

Staufen is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind RNAs having double-stranded secondary structures. The human homologue of staufen encoded by STAU, in addition contains a microtubule- binding domain similar to that of microtubule-associated protein 1B, and binds tubulin. The STAU gene product has been shown to be present in the cytoplasm in association with the rough endoplasmic reticulum (RER), implicating this protein in the transport of mRNA via the microtubule network to the RER, the site of translation. Five transcript variants resulting from alternative splicing of STAU gene and encoding three isoforms have been described. Three of these variants encode the same isoform, however, differ in their 5'UTR. [provided by RefSeq, Jul 2008]

Uniprot Description

STAU: Binds double-stranded RNA (regardless of the sequence) and tubulin. May play a role in specific positioning of mRNAs at given sites in the cell by cross-linking cytoskeletal and RNA components, and in stimulating their translation at the site. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: RNA-binding

Chromosomal Location of Human Ortholog: 20q13.1

Cellular Component: microtubule associated complex; cell soma; rough endoplasmic reticulum; membrane; endoplasmic reticulum; stress granule; dendrite; cytoplasm

Molecular Function: protein binding; double-stranded RNA binding; protein phosphatase 1 binding

Biological Process: intracellular mRNA localization; positive regulation of viral genome replication; positive regulation of viral protein levels in host cell