Rabbit STAT3 Polyclonal Antibody | anti-STAT3 antibody

STAT3 (Signal Transducer and Activator of Transcription 3, Acute-phase Response Factor, APRF, FLJ20882, MGC16063) (MaxLight 490)

Cat. Num. AAA6500996

• Gene Names: STAT3; APRF; HIES
• Reactivity: Human, Mouse, Rat
• Applications: Immunocytochemistry, Immunoblot, Western Blot, Immunoprecipitation
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: STAT3; Polyclonal Antibody; STAT3 (Signal Transducer and Activator of Transcription 3; Acute-phase Response Factor; APRF; FLJ20882; MGC16063) (MaxLight 490); anti-STAT3 antibody

• Host: Rabbit
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes STAT3 (92kD). A second unknown band at 50kD may be observed with longer exposures or at high concentrations of the antibody. Species Crossreactivity: Human, rat and mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.

• Applicable Applications for anti-STAT3 antibody: Immunocytochemistry (ICC), Immunoblot (IB), Immunoprecipitation (IP), Gel Shift Assay
• Application Notes: ICC: 10ug/ml shows positive immunostaining for STAT3 in A431 cells fixed with 95% ethanol, 5% acetic acid.; IB: 0.5-2ug/ml detects STAT3 in RIPA lysates from EGF stimulated human A431 cells and previously from mouse WEHI and rat L6. EGF-stimulated A431 cell lysate was resolved by electrophoresis, transferred to nitrocellulose and probed with anti-STAT3 (2ug/ml). Proteins were visualized using a goat anti-rabbit secondary antibody conjugated to HRP and a chemiluminescence detection system.; IP: 4ug immunoprecipitates STAT 3 from 500ug of EGF-stimulated A431 RIPA lysate.; Applications are based on unconjugated antibody.
• Immunogen: Bacterially expressed GST fusion protein corresponding to human STAT3 (aa688-722, RPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTI). The immunizing sequence is identical in mouse and rat STAT3. The first 28aa are identical to mouse STAT3B.
• Conjugate: MaxLight490
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Related Product Information for anti-STAT3 antibody

Cytokines and growth factors bind to specific cellular receptors that induce differential phosphorylation and activation of proteins called STATs (for Signal Transducers and Activators of Transcription). STAT3 is phosphorylated on a tyrosine residue after treatment of cells with Epidermal Growth Factor and Interleukin-6. It is not phosphorylated after treatment of cells with Interferon gamma. Phosphorylated STAT3 can either form homodimers with itself or heterodimers with STAT1 alpha. These complexes can bind to specific sequences in nuclear DNA and likely modulate gene transcription.

Product Categories/Family for anti-STAT3 antibody

Antibodies; Transcription Factors; STAT

References

1. Ernst, M., et al., J. Biol. Chem. 274: 9729-9737 (1999). 2. Li, W., et al., J. Biol. Chem. 274: 9686-9691 (1999). 3. Yamamura, Y., et al., Mol. Cell. Biol. 18: 1172-1180 (1998). 4. Zong, Z., et al., Science 264: 95-98 (1994). 5. Darnell, Jr. J.E., et al., Science 264: 1415-1420 (1994). 6. Akira, S., et al., Cell 77: 63-71 (1994). 7. Zhang, E., et al., Science 267: 1990-1994 (1995).

NCBI and Uniprot Product Information

• NCBI GI #: 21618338
• NCBI GeneID: 6774
• NCBI Accession #: NP_003141.2
• NCBI GenBank Nucleotide #: NM_003150.3
• UniProt Accession #: P40763; O14916; Q9BW54; A8K7B8
• Molecular Weight: 88,068 Da
• NCBI Official Full Name: signal transducer and activator of transcription 3 isoform 2
• NCBI Official Synonym Full Names: signal transducer and activator of transcription 3 (acute-phase response factor)
• NCBI Official Symbol: STAT3
• NCBI Official Synonym Symbols: APRF; HIES
• NCBI Protein Information: signal transducer and activator of transcription 3; DNA-binding protein APRF; acute-phase response factor
• UniProt Protein Name: Signal transducer and activator of transcription 3
• Protein Family: Signal transducer and activator of transcription
• UniProt Gene Name: STAT3
• UniProt Synonym Gene Names: APRF
• UniProt Entry Name: STAT3_HUMAN

NCBI Description

The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein is activated through phosphorylation in response to various cytokines and growth factors including IFNs, EGF, IL5, IL6, HGF, LIF and BMP2. This protein mediates the expression of a variety of genes in response to cell stimuli, and thus plays a key role in many cellular processes such as cell growth and apoptosis. The small GTPase Rac1 has been shown to bind and regulate the activity of this protein. PIAS3 protein is a specific inhibitor of this protein. Three alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

STAT3: transcription factor of the STAT family. Phosphorylated and activated by receptor-associated kinases downstream of many cytokines and growth-factor receptors. Constitutively active in a number of human tumors. Forms homo- or heterodimers that translocate into the nucleus where they regulate transcription. Two alternatively spliced isoforms have been described.

Protein type: Transcription factor; Nuclear receptor co-regulator; Motility/polarity/chemotaxis; DNA-binding

Chromosomal Location of Human Ortholog: 17q21.31

Cellular Component: nucleoplasm; cytoplasm; mitochondrial inner membrane; plasma membrane; cytosol; nucleus

Molecular Function: protein dimerization activity; protein binding; ligand-dependent nuclear receptor activity; signal transducer activity; DNA binding; sequence-specific DNA binding; protein kinase binding; transcription factor binding; protein phosphatase binding; transcription factor activity; CCR5 chemokine receptor binding; glucocorticoid receptor binding

Biological Process: transcription from RNA polymerase II promoter; nerve growth factor receptor signaling pathway; viral reproduction; somatic stem cell maintenance; positive regulation of transcription, DNA-dependent; radial glial cell differentiation; thermoregulation; negative regulation of transcription from RNA polymerase II promoter; glucose homeostasis; signal transduction; response to estradiol stimulus; negative regulation of cell proliferation; astrocyte differentiation; regulation of transcription, DNA-dependent; protein import into nucleus; acute-phase response; negative regulation of glycolysis; positive regulation of Notch signaling pathway; response to drug; nervous system development; intracellular receptor-mediated signaling pathway; eating behavior; cytokine and chemokine mediated signaling pathway; regulation of multicellular organism growth; JAK-STAT cascade; cellular response to hormone stimulus; regulation of transcription from RNA polymerase II promoter; cell proliferation; response to ethanol; sexual reproduction; positive regulation of transcription from RNA polymerase II promoter; eye photoreceptor cell differentiation; cell motility; phosphorylation

Disease: Hyper-ige Recurrent Infection Syndrome, Autosomal Dominant; Autoimmune Disease, Multisystem, Infantile-onset