Western Blot (WB)
(Lanes:Lane 1: 30ug STARD8 transfected HEK293T lysateLane 2: 30ug HEK293T lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit-HRP Anti-rabbit-HRPSecondary Antibody Dilution:1:10,000Gene Name:STARD8Submitted by:Dr Frankie Ko Chi Fat, Lo-Kong Chan, Irene O.L. Ng, Judy Wai Ping Yam; Department of Pathology, The University of Hong Kong)
Rabbit anti-Human STARD8 Polyclonal Antibody | anti-STARD8 antibody
STARD8 antibody - N-terminal region
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
STARD8; Polyclonal Antibody; STARD8 antibody - N-terminal region; anti-STARD8 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KKRHRNRSFLKHLESLRRKEKSGSQQAEPKHSPATSEKVSKASSFRSCRG
Sequence Length
1103
Applicable Applications for anti-STARD8 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human STARD8
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Lanes:Lane 1: 30ug STARD8 transfected HEK293T lysateLane 2: 30ug HEK293T lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit-HRP Anti-rabbit-HRPSecondary Antibody Dilution:1:10,000Gene Name:STARD8Submitted by:Dr Frankie Ko Chi Fat, Lo-Kong Chan, Irene O.L. Ng, Judy Wai Ping Yam; Department of Pathology, The University of Hong Kong)
Western Blot (WB)
(Lanes:Lane 1: 30ug STARD8 transfected HEK293T lysateLane 2: 30ug HEK293T lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit-HRP Anti-rabbit-HRPSecondary Antibody Dilution:1:10,000Gene Name:STARD8Submitted by:Dr Frankie Ko Chi Fat, Lo-Kong Chan, Irene O.L. Ng, Judy Wai Ping Yam; Department of Pathology, The University of Hong Kong)
Western Blot (WB)
(WB Suggested Anti-STARD8 AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole Cell)
Western Blot (WB)
(WB Suggested Anti-STARD8 AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole Cell)
Related Product Information for anti-STARD8 antibody
This is a rabbit polyclonal antibody against STARD8. It was validated on Western Blot
Target Description: This gene encodes a member of a subfamily of Rho GTPase activating proteins that contain a steroidogenic acute regulatory protein related lipid transfer domain. The encoded protein localizes to focal adhesions and may be involved in regulating cell morphology. This protein may also function as a tumor suppressor.
Target Description: This gene encodes a member of a subfamily of Rho GTPase activating proteins that contain a steroidogenic acute regulatory protein related lipid transfer domain. The encoded protein localizes to focal adhesions and may be involved in regulating cell morphology. This protein may also function as a tumor suppressor.
Product Categories/Family for anti-STARD8 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
122kDa
NCBI Official Full Name
stAR-related lipid transfer protein 8 isoform a
UniProt Protein Name
StAR-related lipid transfer protein 8
Protein Family
UniProt Gene Name
STARD8
UniProt Synonym Gene Names
DLC3; KIAA0189; DLC-3; StARD8
UniProt Entry Name
STAR8_HUMAN
Uniprot Description
Function: Accelerates GTPase activity of RHOA and CDC42, but not RAC1. Stimulates the hydrolysis of phosphatidylinositol 4,5-bisphosphate by PLCD1. Ref.7
Subunit structure: Binds both the SH2 and PTB domains of TNS1.
Subcellular location: Cell junction › focal adhesion Ref.7.
Tissue specificity: Widely expressed with highest levels in kidney, lung and placenta. Ref.8
Sequence similarities: Contains 1 Rho-GAP domain.Contains 1 START domain.
Sequence caution: The sequence BAA11506.2 differs from that shown. Reason: Erroneous initiation.
Similar Products
Product Notes
The STARD8 stard8 (Catalog #AAA3214437) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The STARD8 antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's STARD8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the STARD8 stard8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KKRHRNRSFL KHLESLRRKE KSGSQQAEPK HSPATSEKVS KASSFRSCRG. It is sometimes possible for the material contained within the vial of "STARD8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
