Western Blot (WB)
(WB Suggested Anti-ST8SIA6 Antibody Titration: 0.2-1 ug/mlPositive Control: HT1080 cell lysate)
Rabbit ST8SIA6 Polyclonal Antibody | anti-ST8SIA6 antibody
ST8SIA6 antibody - middle region
Gene Names
ST8SIA6; SIA8F; SIAT8F; SIAT8-F; ST8SiaVI; ST8SIA-VI
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ST8SIA6; Polyclonal Antibody; ST8SIA6 antibody - middle region; anti-ST8SIA6 antibody
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LEESKARQKVLFFHPKYLKDLALFWRTKGVTAYRLSTGLMITSVAVELCK
Sequence Length
398
Applicable Applications for anti-ST8SIA6 antibody
Western Blot (WB)
Homology
Cow: 86%; Guinea Pig: 92%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ST8SIA6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-ST8SIA6 Antibody Titration: 0.2-1 ug/mlPositive Control: HT1080 cell lysate)
Western Blot (WB)
(WB Suggested Anti-ST8SIA6 Antibody Titration: 0.2-1 ug/mlPositive Control: HT1080 cell lysate)
Related Product Information for anti-ST8SIA6 antibody
This is a rabbit polyclonal antibody against ST8SIA6. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: Sialic acid is a key determinate of oligosaccharide structures involved in cell-cell communication, cell-substrate interaction, adhesion, and protein targeting. ST8SIA6 belongs to a family of sialyltransferases (EC 2.4.99.8) that synthesize sialylglycocon
Target Description: Sialic acid is a key determinate of oligosaccharide structures involved in cell-cell communication, cell-substrate interaction, adhesion, and protein targeting. ST8SIA6 belongs to a family of sialyltransferases (EC 2.4.99.8) that synthesize sialylglycocon
Product Categories/Family for anti-ST8SIA6 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
alpha-2,8-sialyltransferase 8F isoform 1
NCBI Official Synonym Full Names
ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 6
NCBI Official Symbol
ST8SIA6
NCBI Official Synonym Symbols
SIA8F; SIAT8F; SIAT8-F; ST8SiaVI; ST8SIA-VI
NCBI Protein Information
alpha-2,8-sialyltransferase 8F
UniProt Protein Name
Alpha-2,8-sialyltransferase 8F
Protein Family
UniProt Gene Name
ST8SIA6
UniProt Synonym Gene Names
SIAT8F; SIAT8-F; ST8SiaVI
UniProt Entry Name
SIA8F_HUMAN
NCBI Description
This gene encodes a member of the glycosyltransferase 29 protein family. Members of this protein family synthesize sialylglycoconjugates. Sialylation may contribute to multidrug resistance in cancer cells. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2016]
Research Articles on ST8SIA6
Similar Products
Product Notes
The ST8SIA6 st8sia6 (Catalog #AAA3207397) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ST8SIA6 antibody - middle region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ST8SIA6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ST8SIA6 st8sia6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LEESKARQKV LFFHPKYLKD LALFWRTKGV TAYRLSTGLM ITSVAVELCK. It is sometimes possible for the material contained within the vial of "ST8SIA6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
