Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (ST6GAL1 rabbit polyclonal antibody. Western Blot analysis of ST6GAL1 expression in mouse liver.)

Rabbit anti-Human, Mouse ST6GAL1 Polyclonal Antibody | anti-ST6GAL1 antibody

ST6GAL1 (Beta-galactoside alpha-2,6-sialyltransferase 1, Alpha 2,6-ST 1, B Cell Antigen CD75, CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 1, ST6Gal I, ST6GalI, Sialyltransferase 1, SIAT1) (PE)

Gene Names
ST6GAL1; ST6N; SIAT1; ST6GalI
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ST6GAL1; Polyclonal Antibody; ST6GAL1 (Beta-galactoside alpha-2; 6-sialyltransferase 1; Alpha 2; 6-ST 1; B Cell Antigen CD75; CMP-N-acetylneuraminate-beta-galactosamide-alpha-2; ST6Gal I; ST6GalI; Sialyltransferase 1; SIAT1) (PE); anti-ST6GAL1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ST6GAL1. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-ST6GAL1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human ST6GAL1, aa1-175 (NP_775324.1).
Immunogen Sequence
MNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQMPWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHC
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(ST6GAL1 rabbit polyclonal antibody. Western Blot analysis of ST6GAL1 expression in mouse liver.)

Western Blot (WB) (ST6GAL1 rabbit polyclonal antibody. Western Blot analysis of ST6GAL1 expression in mouse liver.)

Western Blot (WB)

(Western Blot analysis of ST6GAL1 expression in transfected 293T cell line by ST6GAL1 polyclonal antibody. Lane 1: ST6GAL1 transfected lysate (20.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ST6GAL1 expression in transfected 293T cell line by ST6GAL1 polyclonal antibody. Lane 1: ST6GAL1 transfected lysate (20.8kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-ST6GAL1 antibody
Transfers sialic acid from the donor of substrate CMP-sialic acid to galactose containing acceptor substrates.
Product Categories/Family for anti-ST6GAL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20,764 Da
NCBI Official Full Name
beta-galactoside alpha-2,6-sialyltransferase 1 isoform b
NCBI Official Synonym Full Names
ST6 beta-galactoside alpha-2,6-sialyltransferase 1
NCBI Official Symbol
ST6GAL1
NCBI Official Synonym Symbols
ST6N; SIAT1; ST6GalI
NCBI Protein Information
beta-galactoside alpha-2,6-sialyltransferase 1
UniProt Protein Name
Beta-galactoside alpha-2,6-sialyltransferase 1
UniProt Gene Name
ST6GAL1
UniProt Synonym Gene Names
SIAT1; Alpha 2,6-ST 1; ST6GalI
UniProt Entry Name
SIAT1_HUMAN

NCBI Description

This gene encodes a member of glycosyltransferase family 29. The encoded protein is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The protein, which is normally found in the Golgi but can be proteolytically processed to a soluble form, is involved in the generation of the cell-surface carbohydrate determinants and differentiation antigens HB-6, CD75, and CD76. This gene has been incorrectly referred to as CD75. Three transcript variants encoding two different isoforms have been described. [provided by RefSeq, Aug 2009]

Uniprot Description

SIAT1: a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. Is normally found in the trans cisternae of the Golgi but which can be proteolytically processed to a soluble form, is involved in the generation of the cell-surface carbohydrate determinants and differentiation antigens HB-6, CDw75, and CD76. This protein is a member of glycosyltransferase family 29. Three transcript variants encoding two different isoforms have been found.

Protein type: EC 2.4.99.1; Membrane protein, integral; Glycan Metabolism - N-glycan biosynthesis; Transferase

Chromosomal Location of Human Ortholog: 3q27.3

Cellular Component: Golgi membrane; integral to Golgi membrane

Molecular Function: sialyltransferase activity; beta-galactoside alpha-2,6-sialyltransferase activity

Biological Process: protein amino acid O-linked glycosylation; cellular protein metabolic process; O-glycan processing; dolichol-linked oligosaccharide biosynthetic process; protein amino acid N-linked glycosylation via asparagine; post-translational protein modification; N-acetylneuraminate metabolic process; humoral immune response

Research Articles on ST6GAL1

Similar Products

Product Notes

The ST6GAL1 st6gal1 (Catalog #AAA6395190) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ST6GAL1 (Beta-galactoside alpha-2,6-sialyltransferase 1, Alpha 2,6-ST 1, B Cell Antigen CD75, CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 1, ST6Gal I, ST6GalI, Sialyltransferase 1, SIAT1) (PE) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's ST6GAL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ST6GAL1 st6gal1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ST6GAL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.