<
Western Blot (WB)
(Host: RabbitTarget Name: EGFL8Sample Type: HelaAntibody Dilution: 1.0ug/mlST3GAL4 is supported by BioGPS gene expression data to be expressed in HeLa)
Rabbit ST3GAL4 Polyclonal Antibody | anti-ST3GAL4 antibody
ST3GAL4 antibody - middle region
Gene Names
ST3GAL4; STZ; SAT3; ST-4; CGS23; SIAT4; NANTA3; SIAT4C; ST3GalIV; ST3GalA.2; gal-NAc6S
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ST3GAL4; Polyclonal Antibody; ST3GAL4 antibody - middle region; anti-ST3GAL4 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IKQKPTTGLLAITLALHLCDLVHIAGFGYPDAYNKKQTIHYYEQITLKSM
Sequence Length
329
Applicable Applications for anti-ST3GAL4 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ST3GAL4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: EGFL8Sample Type: HelaAntibody Dilution: 1.0ug/mlST3GAL4 is supported by BioGPS gene expression data to be expressed in HeLa)
Western Blot (WB)
(Host: RabbitTarget Name: EGFL8Sample Type: HelaAntibody Dilution: 1.0ug/mlST3GAL4 is supported by BioGPS gene expression data to be expressed in HeLa)
Western Blot (WB)
(Host: RabbitTarget Name: NOP56Sample Type: MCF7Antibody Dilution: 1.0ug/mlST3GAL4 is supported by BioGPS gene expression data to be expressed in MCF7)
Western Blot (WB)
(Host: RabbitTarget Name: NOP56Sample Type: MCF7Antibody Dilution: 1.0ug/mlST3GAL4 is supported by BioGPS gene expression data to be expressed in MCF7)
Western Blot (WB)
(Host: RabbitTarget Name: ST3GAL4Sample Tissue: Human 786-0 Whole CellAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: ST3GAL4Sample Tissue: Human 786-0 Whole CellAntibody Dilution: 1ug/ml)
Western Blot (WB)
(WB Suggested Anti-ST3GAL4 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysateST3GAL4 is supported by BioGPS gene expression data to be expressed in 721_B)
Western Blot (WB)
(WB Suggested Anti-ST3GAL4 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysateST3GAL4 is supported by BioGPS gene expression data to be expressed in 721_B)
Related Product Information for anti-ST3GAL4 antibody
This is a rabbit polyclonal antibody against ST3GAL4. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: It may catalyze the formation of the NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc- or NeuAc-alpha-2,3-Gal-beta-1,3-GlcNAc-sequences found in terminal carbohydrate groups of glycoproteins and glycolipids. It may be involved in the biosynthesis of the sialyl Lewis X determinant.Synthesis of alpha-2,3-linked sialic acid to Gal(beta-1,3)GalNAc is mediated by at least 3 distinct beta-galactoside alpha-2,3-sialyltransferases (EC 2.4.99.4), including ST3GAL4. In contrast, only a single gene encodes the beta-galactoside alpha-2,6-sialyltransferase (EC 2.4.99.1), ST6GAL1 (MIM 109675) (Chang et al., 1995 [PubMed 7655169]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Target Description: It may catalyze the formation of the NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc- or NeuAc-alpha-2,3-Gal-beta-1,3-GlcNAc-sequences found in terminal carbohydrate groups of glycoproteins and glycolipids. It may be involved in the biosynthesis of the sialyl Lewis X determinant.Synthesis of alpha-2,3-linked sialic acid to Gal(beta-1,3)GalNAc is mediated by at least 3 distinct beta-galactoside alpha-2,3-sialyltransferases (EC 2.4.99.4), including ST3GAL4. In contrast, only a single gene encodes the beta-galactoside alpha-2,6-sialyltransferase (EC 2.4.99.1), ST6GAL1 (MIM 109675) (Chang et al., 1995 [PubMed 7655169]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-ST3GAL4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
37kDa
NCBI Official Full Name
CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform 1
NCBI Official Synonym Full Names
ST3 beta-galactoside alpha-2,3-sialyltransferase 4
NCBI Official Symbol
ST3GAL4
NCBI Official Synonym Symbols
STZ; SAT3; ST-4; CGS23; SIAT4; NANTA3; SIAT4C; ST3GalIV; ST3GalA.2; gal-NAc6S
NCBI Protein Information
CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4
UniProt Protein Name
SIAT4C protein
UniProt Gene Name
SIAT4C
UniProt Synonym Gene Names
ST3GAL4
UniProt Entry Name
Q6IBE6_HUMAN
NCBI Description
This gene encodes a member of the glycosyltransferase 29 family, a group of enzymes involved in protein glycosylation. The encoded protein is targeted to Golgi membranes but may be proteolytically processed and secreted. The gene product may also be involved in the increased expression of sialyl Lewis X antigen seen in inflammatory responses. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011]
Research Articles on ST3GAL4
Similar Products
Product Notes
The ST3GAL4 siat4c (Catalog #AAA3208289) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ST3GAL4 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's ST3GAL4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ST3GAL4 siat4c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IKQKPTTGLL AITLALHLCD LVHIAGFGYP DAYNKKQTIH YYEQITLKSM. It is sometimes possible for the material contained within the vial of "ST3GAL4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
