Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (ST3GAL4 monoclonal antibody. Western Blot analysis of ST3GAL4 expression in MCF-7.)

Mouse anti-Human ST3GAL4 Monoclonal Antibody | anti-ST3GAL4 antibody

ST3GAL4 (NANTA3, SIAT4C, STZ, FLJ11867, FLJ46764, CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4, Alpha 2,3-ST 4, Beta-galactoside alpha-2,3-sialyltransferase 4, Alpha 2,3-sialyltransferase IV, Gal-NAc6S, Gal-beta-1,4-GalNAc-alph

Gene Names
ST3GAL4; STZ; SAT3; CGS23; SIAT4; NANTA3; SIAT4C; ST3GalIV
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
ST3GAL4; Monoclonal Antibody; ST3GAL4 (NANTA3; SIAT4C; STZ; FLJ11867; FLJ46764; CMP-N-acetylneuraminate-beta-galactosamide-alpha-2; 3-sialyltransferase 4; Alpha 2; 3-ST 4; Beta-galactoside alpha-2; 3-sialyltransferase IV; Gal-NAc6S; Gal-beta-1; 4-GalNAc-alph; Anti -ST3GAL4 (NANTA3; anti-ST3GAL4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1F4
Specificity
Recognizes human ST3GAL4.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
FYFPIPEKKEPCLQGEAESKASKLFGNYSRDQPIFLRLEDYFWVKTPSAYELPYGTKGSEDLLLRVLAITSSSIPKNIQSLRCRRCVVVGNGHRLRNSSL*
Applicable Applications for anti-ST3GAL4 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa31-131 from human ST3GAL4 (NP_006269) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(ST3GAL4 monoclonal antibody. Western Blot analysis of ST3GAL4 expression in MCF-7.)

Western Blot (WB) (ST3GAL4 monoclonal antibody. Western Blot analysis of ST3GAL4 expression in MCF-7.)

Testing Data

(Detection limit for recombinant GST tagged ST3GAL4 is 3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ST3GAL4 is 3ng/ml as a capture antibody.)
Related Product Information for anti-ST3GAL4 antibody
It may catalyze the formation of the NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc- or NeuAc-alpha-2,3-Gal-beta-1,3-GlcNAc-sequences found in terminal carbohydrate groups of glycoproteins and glycolipids. It may be involved in the biosynthesis of the sialyl Lewis X determinant. Also acts on the corresponding 1,3-galactosyl derivative.
Product Categories/Family for anti-ST3GAL4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
38,045 Da
NCBI Official Full Name
ST3GAL4 protein
NCBI Official Synonym Full Names
ST3 beta-galactoside alpha-2,3-sialyltransferase 4
NCBI Official Symbol
ST3GAL4
NCBI Official Synonym Symbols
STZ; SAT3; CGS23; SIAT4; NANTA3; SIAT4C; ST3GalIV
NCBI Protein Information
CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4; ST-4; SAT-3; SIAT4-C; ST3GalA.2; gal-NAc6S; alpha 2,3-ST 4; alpha 2,3-sialyltransferase IV; alpha-3-N-acetylneuraminyltransferase; beta-galactoside alpha-2,3-sialyltransferase 4; gal-beta-1,4-GalNAc-alpha-2,3-sialyltransferase; sialyltransferase 4C (beta-galactoside alpha-2,3-sialytransferase); sialyltransferase 4C (beta-galactosidase alpha-2,3-sialytransferase)
UniProt Protein Name
CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4
UniProt Gene Name
ST3GAL4
UniProt Synonym Gene Names
CGS23; NANTA3; SIAT4C; STZ; Alpha 2,3-ST 4; Beta-galactoside alpha-2,3-sialyltransferase 4; ST3GalIV; SIAT4-C
UniProt Entry Name
SIA4C_HUMAN

NCBI Description

This gene encodes a member of the glycosyltransferase 29 family, a group of enzymes involved in protein glycosylation. The encoded protein is targeted to Golgi membranes but may be proteolytically processed and secreted. The gene product may also be involved in the increased expression of sialyl Lewis X antigen seen in inflammatory responses. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011]

Uniprot Description

ST3GAL4: It may catalyze the formation of the NeuAc-alpha-2,3- Gal-beta-1,3-GalNAc- or NeuAc-alpha-2,3-Gal-beta-1,3-GlcNAc- sequences found in terminal carbohydrate groups of glycoproteins and glycolipids. It may be involved in the biosynthesis of the sialyl Lewis X determinant. Also acts on the corresponding 1,3- galactosyl derivative. Belongs to the glycosyltransferase 29 family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Glycan Metabolism - glycosphingolipid biosynthesis - lacto and neolacto series; Glycan Metabolism - keratan sulfate biosynthesis; EC 2.4.99.-; Transferase

Chromosomal Location of Human Ortholog: 11q24.2

Cellular Component: Golgi membrane; membrane; integral to Golgi membrane

Molecular Function: monosialoganglioside sialyltransferase activity; beta-galactoside alpha-2,3-sialyltransferase activity

Biological Process: keratan sulfate metabolic process; protein amino acid O-linked glycosylation; cellular protein metabolic process; glycosaminoglycan metabolic process; dolichol-linked oligosaccharide biosynthetic process; O-glycan processing; carbohydrate metabolic process; keratan sulfate biosynthetic process; pathogenesis; protein amino acid N-linked glycosylation via asparagine; post-translational protein modification; cognition

Research Articles on ST3GAL4

Similar Products

Product Notes

The ST3GAL4 st3gal4 (Catalog #AAA6001412) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ST3GAL4 (NANTA3, SIAT4C, STZ, FLJ11867, FLJ46764, CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4, Alpha 2,3-ST 4, Beta-galactoside alpha-2,3-sialyltransferase 4, Alpha 2,3-sialyltransferase IV, Gal-NAc6S, Gal-beta-1,4-GalNAc-alph reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ST3GAL4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the ST3GAL4 st3gal4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: FYFPIPEKKE PCLQGEAESK ASKLFGNYSR DQPIFLRLED YFWVKTPSAY ELPYGTKGSE DLLLRVLAIT SSSIPKNIQS LRCRRCVVVG NGHRLRNSSL *. It is sometimes possible for the material contained within the vial of "ST3GAL4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.