Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Colon, myenteric plexus)

Rabbit SSBP2 Polyclonal Antibody | anti-SSBP2 antibody

SSBP2 antibody - N-terminal region

Gene Names
SSBP2; HSPC116; SOSS-B2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
SSBP2; Polyclonal Antibody; SSBP2 antibody - N-terminal region; anti-SSBP2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YPGGPRPPLRIPNQALGGVPGSQPLLPSGMDPTRQQGHPNMGGPMQRMTP
Sequence Length
361
Applicable Applications for anti-SSBP2 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SSBP2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Colon, myenteric plexus)

Immunohistochemistry (IHC) (Colon, myenteric plexus)

Immunohistochemistry (IHC)

(IHC Information: Paraffin embedded breast tissue, tested with an antibody dilution of 5 ug/ml.)

Immunohistochemistry (IHC) (IHC Information: Paraffin embedded breast tissue, tested with an antibody dilution of 5 ug/ml.)

Immunohistochemistry (IHC)

(Rabbit Anti-SSBP2 antibodyParaffin Embedded Tissue: Human Brain cell Cellular Data: Nerve fibre of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Immunohistochemistry (IHC) (Rabbit Anti-SSBP2 antibodyParaffin Embedded Tissue: Human Brain cell Cellular Data: Nerve fibre of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Immunohistochemistry (IHC)

(Rabbit Anti-SSBP2 AntibodyParaffin Embedded Tissue: Human BrainCellular Data: Nerve fibreAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Immunohistochemistry (IHC) (Rabbit Anti-SSBP2 AntibodyParaffin Embedded Tissue: Human BrainCellular Data: Nerve fibreAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Immunohistochemistry (IHC)

(Rabbit Anti-SSBP2 AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Immunohistochemistry (IHC) (Rabbit Anti-SSBP2 AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Western Blot (WB)

(WB Suggested Anti-SSBP2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:7812500Positive Control: Raji cell lysate)

Western Blot (WB) (WB Suggested Anti-SSBP2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:7812500Positive Control: Raji cell lysate)
Related Product Information for anti-SSBP2 antibody
This is a rabbit polyclonal antibody against SSBP2. It was validated on Western Blot and immunohistochemistry

Target Description: SSBP2 is a member of a closely related, evolutionarily conserved, and ubiquitously expressed gene family. It is also a potential tumor suppressor.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
single-stranded DNA-binding protein 2 isoform 2
NCBI Official Synonym Full Names
single stranded DNA binding protein 2
NCBI Official Symbol
SSBP2
NCBI Official Synonym Symbols
HSPC116; SOSS-B2
NCBI Protein Information
single-stranded DNA-binding protein 2
UniProt Protein Name
Single-stranded DNA-binding protein 2
UniProt Gene Name
SSBP2
UniProt Synonym Gene Names
SSDP2
UniProt Entry Name
SSBP2_HUMAN

NCBI Description

This gene encodes a subunit of a protein complex that interacts with single-stranded DNA and is involved in the DNA damage response and maintenance of genome stability. The encoded protein may also play a role in telomere repair. A variant of this gene may be associated with survival in human glioblastoma patients. [provided by RefSeq, Sep 2016]

Uniprot Description

SSBP2: 2 isoforms of the human protein are produced by alternative splicing

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 5q14.1

Cellular Component: cytoplasm; nucleus

Molecular Function: single-stranded DNA binding

Biological Process: regulation of transcription, DNA-dependent

Research Articles on SSBP2

Similar Products

Product Notes

The SSBP2 ssbp2 (Catalog #AAA3200587) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SSBP2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SSBP2 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the SSBP2 ssbp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YPGGPRPPLR IPNQALGGVP GSQPLLPSGM DPTRQQGHPN MGGPMQRMTP. It is sometimes possible for the material contained within the vial of "SSBP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.