Rabbit SRSF7 Polyclonal Antibody | anti-SRSF7 antibody

SRSF7 Polyclonal Antibody

Cat. Num. AAA9140982

• Gene Names: SRSF7; 9G8; AAG3; SFRS7
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot
• Purity: Affinity Purification
• Synonyms: SRSF7; Polyclonal Antibody; SRSF7 Polyclonal Antibody; 9G8; AAG3; SFRS7; serine/arginine-rich splicing factor 7; anti-SRSF7 antibody

• Host: Rabbit
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Affinity Purification
• Form/Format: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
• Concentration: 3.67 mg/ml (varies by lot)
• Sequence Length: 238

• Applicable Applications for anti-SRSF7 antibody: Western Blot (WB)
• Application Notes: WB: 1:500-1:1000
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 60-120 of human SRSF7 (NP_001026854).
• Immunogen Sequence: AEDAVRGLDGKVICGSRVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGEKGHYAYDCH
• Cellular Location: Cytoplasm, Nucleus
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-SRSF7 Polyclonal Antibody)

Related Product Information for anti-SRSF7 antibody

The protein encoded by this gene is a member of the serine/arginine (SR)-rich family of pre-mRNA splicing factors, which constitute part of the spliceosome. Each of these factors contains an RNA recognition motif (RRM) for binding RNA and an RS domain for binding other proteins. The RS domain is rich in serine and arginine residues and facilitates interaction between different SR splicing factors. In addition to being critical for mRNA splicing, the SR proteins have also been shown to be involved in mRNA export from the nucleus and in translation. Two transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

• NCBI GI #: 72534660
• NCBI GeneID: 6432
• NCBI Accession #: NP_001026854.1
• NCBI GenBank Nucleotide #: NP_001026854.1
• UniProt Accession #: Q16629
• Molecular Weight: 15kDa; 26kDa; 27kDa
• NCBI Official Full Name: serine/arginine-rich splicing factor 7 isoform 1
• NCBI Official Synonym Full Names: serine and arginine rich splicing factor 7
• NCBI Official Symbol: SRSF7
• NCBI Official Synonym Symbols: 9G8; AAG3; SFRS7
• NCBI Protein Information: serine/arginine-rich splicing factor 7
• UniProt Protein Name: Serine/arginine-rich splicing factor 7
• Protein Family: Serine/arginine-rich splicing factor
• UniProt Gene Name: SRSF7
• UniProt Synonym Gene Names: SFRS7
• UniProt Entry Name: SRSF7_HUMAN

NCBI Description

The protein encoded by this gene is a member of the serine/arginine (SR)-rich family of pre-mRNA splicing factors, which constitute part of the spliceosome. Each of these factors contains an N-terminal RNA recognition motif (RRM) for binding RNA and a C-terminal RS domain for binding other proteins. The RS domain is rich in serine and arginine residues and facilitates interaction between different SR splicing factors. In addition to being critical for mRNA splicing, the SR proteins have also been shown to be involved in mRNA export from the nucleus and in translation. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2018]

Uniprot Description

SFRS7: Required for pre-mRNA splicing. Can also modulate alternative splicing in vitro. Represses the splicing of MAPT/Tau exon 10. Belongs to the splicing factor SR family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Spliceosome; RNA splicing; RNA-binding

Chromosomal Location of Human Ortholog: 2p22.1

Cellular Component: nucleoplasm; cytoplasm; nucleus

Molecular Function: protein binding; zinc ion binding; nucleotide binding

Biological Process: transcription from RNA polymerase II promoter; nuclear mRNA splicing, via spliceosome; mRNA export from nucleus; negative regulation of nuclear mRNA splicing, via spliceosome; RNA splicing; gene expression; mRNA 3'-end processing; mRNA processing; termination of RNA polymerase II transcription