Western Blot (WB)
(WB Suggested Anti-SRD5A3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Muscle)
Rabbit SRD5A3 Polyclonal Antibody | anti-SRD5A3 antibody
SRD5A3 antibody - N-terminal region
Gene Names
SRD5A3; CDG1P; CDG1Q; KRIZI; SRD5A2L; SRD5A2L1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SRD5A3; Polyclonal Antibody; SRD5A3 antibody - N-terminal region; anti-SRD5A3 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GLLPGCAIFQDLIRYGKTKCGEPSRPAACRAFDVPKRYFSHFYIISVLWN
Sequence Length
318
Applicable Applications for anti-SRD5A3 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 89%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SRD5A3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-SRD5A3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Muscle)
Western Blot (WB)
(WB Suggested Anti-SRD5A3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Muscle)
Related Product Information for anti-SRD5A3 antibody
This is a rabbit polyclonal antibody against SRD5A3. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: SRD5A3 belongs to the steroid 5-alpha reductase family and converts testosterone (T) into 5-alpha-dihydrotestosterone (DHT).
Target Description: SRD5A3 belongs to the steroid 5-alpha reductase family and converts testosterone (T) into 5-alpha-dihydrotestosterone (DHT).
Product Categories/Family for anti-SRD5A3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
polyprenol reductase
NCBI Official Synonym Full Names
steroid 5 alpha-reductase 3
NCBI Official Symbol
SRD5A3
NCBI Official Synonym Symbols
CDG1P; CDG1Q; KRIZI; SRD5A2L; SRD5A2L1
NCBI Protein Information
polyprenol reductase
UniProt Protein Name
Polyprenol reductase
UniProt Gene Name
SRD5A3
UniProt Synonym Gene Names
SRD5A2L; S5AR 3; SR type 3
UniProt Entry Name
PORED_HUMAN
NCBI Description
The protein encoded by this gene belongs to the steroid 5-alpha reductase family, and polyprenol reductase subfamily. It is involved in the production of androgen 5-alpha-dihydrotestosterone (DHT) from testosterone, and maintenance of the androgen-androgen receptor activation pathway. This protein is also necessary for the conversion of polyprenol into dolichol, which is required for the synthesis of dolichol-linked monosaccharides and the oligosaccharide precursor used for N-linked glycosylation of proteins. Mutations in this gene are associated with congenital disorder of glycosylation type Iq. [provided by RefSeq, Mar 2011]
Research Articles on SRD5A3
Similar Products
Product Notes
The SRD5A3 srd5a3 (Catalog #AAA3209660) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SRD5A3 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's SRD5A3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SRD5A3 srd5a3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GLLPGCAIFQ DLIRYGKTKC GEPSRPAACR AFDVPKRYFS HFYIISVLWN. It is sometimes possible for the material contained within the vial of "SRD5A3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
