Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SRA1 AntibodyTitration: 1.0 ug/mlPositive Control: HT1080 Whole Cell)

Rabbit SRA1 Polyclonal Antibody | anti-SRA1 antibody

SRA1 antibody - middle region

Gene Names
SRA1; SRA; SRAP; STRAA1; pp7684
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SRA1; Polyclonal Antibody; SRA1 antibody - middle region; anti-SRA1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SGPASGVEPTSFPVESEAVMEDVLRPLEQALEDCRGHTRKQVCDDISRRL
Sequence Length
236
Applicable Applications for anti-SRA1 antibody
Western Blot (WB)
Homology
Cow: 79%; Dog: 90%; Guinea Pig: 100%; Horse: 79%; Human: 100%; Mouse: 91%; Rabbit: 86%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SRA1 AntibodyTitration: 1.0 ug/mlPositive Control: HT1080 Whole Cell)

Western Blot (WB) (WB Suggested Anti-SRA1 AntibodyTitration: 1.0 ug/mlPositive Control: HT1080 Whole Cell)
Related Product Information for anti-SRA1 antibody
This is a rabbit polyclonal antibody against SRA1. It was validated on Western Blot

Target Description: This gene is involved in transcriptional coactivation by steroid receptors. There is currently data suggesting this gene encodes both a non-coding RNA that functions as part of a ribonucleoprotein complex and a protein coding mRNA. Increased expression of both the transcript and the protein is associated with cancer.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26kDa
NCBI Official Full Name
steroid receptor RNA activator 1 isoform 1
NCBI Official Synonym Full Names
steroid receptor RNA activator 1
NCBI Official Symbol
SRA1
NCBI Official Synonym Symbols
SRA; SRAP; STRAA1; pp7684
NCBI Protein Information
steroid receptor RNA activator 1
UniProt Protein Name
Steroid receptor RNA activator 1
UniProt Gene Name
SRA1
UniProt Synonym Gene Names
SRAP
UniProt Entry Name
SRA1_HUMAN

NCBI Description

Both long non-coding and protein-coding RNAs are transcribed from this gene, and they represent alternatively spliced transcript variants. This gene was initially defined as a non-coding RNA, which is a coactivator for several nuclear receptors (NRs) and is associated with breast cancer. It has now been found that this gene is involved in the regulation of many NR and non-NR activities, including metabolism, adipogenesis and chromatin organization. The long non-coding RNA transcripts interact with a variety of proteins, including the protein encoded by this gene. The encoded protein acts as a transcriptional repressor by binding to the non-coding RNA. [provided by RefSeq, Mar 2012]

Uniprot Description

SRA1: Functional RNA which acts as a transcriptional coactivator that selectively enhances steroid receptor-mediated transactivation ligand-independently through a mechanism involving the modulating N-terminal domain (AF-1) of steroid receptors. Also mediates transcriptional coactivation of steroid receptors ligand- dependently through the steroid-binding domain (AF-2). Enhances cellular proliferation and differentiation and promotes apoptosis in vivo. May play a role in tumorigenesis. Belongs to the SRA1 family.

Protein type: Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 5q31.3

Cellular Component: nucleoplasm; microtubule cytoskeleton; intercellular bridge; cytoplasm; plasma membrane; nucleus; ribonucleoprotein complex

Molecular Function: protein binding; ligand-dependent nuclear receptor transcription coactivator activity; transcription coactivator activity

Biological Process: regulation of apoptosis; cell proliferation; transcription, DNA-dependent; regulation of transcription, DNA-dependent; apoptosis; cell differentiation

Research Articles on SRA1

Similar Products

Product Notes

The SRA1 sra1 (Catalog #AAA3215308) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SRA1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SRA1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SRA1 sra1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SGPASGVEPT SFPVESEAVM EDVLRPLEQA LEDCRGHTRK QVCDDISRRL. It is sometimes possible for the material contained within the vial of "SRA1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.