Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using SPON1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Rabbit anti-Mouse SPON1 Polyclonal Antibody | anti-SPON1 antibody
SPON1 Polyclonal Antibody
Gene Names
SPON1; f-spondin; VSGP/F-spondin
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
SPON1; Polyclonal Antibody; SPON1 Polyclonal Antibody; f-spondin; VSGP/F-spondin; anti-SPON1 antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
FSDETLDKVPKSEGYCSRILRAQGTRREGYTEFSLRVEGDPDFYKPGTSYRVTLSAAPPSYFRGFTLIALRENREGDKEEDHAGTFQIIDEEETQFMSNCPVAVTESTPRRRTRIQVFWIAPPAGTGCVILKASIVQKRIIYFQDEGSLTKKLCEQDSTFDGVTDKPILDCCACGTAKYRLTFYGNWSEKTHPKDYPRRANHWSAIIGGSHSKNYVLWEYGGYASEGVKQVAELGSPVKMEEEIRQQSDEVLTVI
Sequence Length
807
Applicable Applications for anti-SPON1 antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human SPON1
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Secreted, extracellular matrix, extracellular space
Positive Samples
mouse kidney, mouse brain
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using SPON1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using SPON1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Product Categories/Family for anti-SPON1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 90kDa
Observed: 91kDa
Observed: 91kDa
NCBI Official Full Name
spondin-1
NCBI Official Synonym Full Names
spondin 1
NCBI Official Symbol
SPON1
NCBI Official Synonym Symbols
f-spondin; VSGP/F-spondin
NCBI Protein Information
spondin-1
UniProt Protein Name
Spondin-1
Protein Family
UniProt Gene Name
SPON1
UniProt Synonym Gene Names
KIAA0762; VSGP
Uniprot Description
Cell adhesion protein that promotes the attachment of spinal cord and sensory neuron cells and the outgrowth of neurites in vitro. May contribute to the growth and guidance of axons in both the spinal cord and the PNS (). Major factor for vascular smooth muscle cell.
Research Articles on SPON1
Similar Products
Product Notes
The SPON1 spon1 (Catalog #AAA9135116) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SPON1 Polyclonal Antibody reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's SPON1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the SPON1 spon1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: FSDETLDKVP KSEGYCSRIL RAQGTRREGY TEFSLRVEGD PDFYKPGTSY RVTLSAAPPS YFRGFTLIAL RENREGDKEE DHAGTFQIID EEETQFMSNC PVAVTESTPR RRTRIQVFWI APPAGTGCVI LKASIVQKRI IYFQDEGSLT KKLCEQDSTF DGVTDKPILD CCACGTAKYR LTFYGNWSEK THPKDYPRRA NHWSAIIGGS HSKNYVLWEY GGYASEGVKQ VAELGSPVKM EEEIRQQSDE VLTVI. It is sometimes possible for the material contained within the vial of "SPON1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
