Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of SPO11 expression in transfected 293T cell line by SPO11 polyclonal antibody. Lane 1: SPO11 transfected lysate (39.38kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human SPO11 Polyclonal Antibody | anti-SPO11 antibody

SPO11 (Meiotic Recombination Protein SPO11, Cancer/testis Antigen 35, CT35)

Gene Names
SPO11; CT35; TOPVIA; SPATA43
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
SPO11; Polyclonal Antibody; SPO11 (Meiotic Recombination Protein SPO11; Cancer/testis Antigen 35; CT35); Anti -SPO11 (Meiotic Recombination Protein SPO11; anti-SPO11 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SPO11.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MAFAPMGPEASFFDVLDRHRESLLAALRRGGREPPTGGSRLASRFEDSVGLQMVSHCTTRKIKSDSPKSAQKFSLILKILSMIYKLVQSNTYATKRDIYYTDSQLFGNQTVVDNIINDISCMLKVSRRSLHILSTSKGLIAGNLRYIEEDGTKVNCTCGATAVAVPSNIQGIRNLVTDAKFVLIVEKDATFQRLLDDNFCNKLSPCIMITGKGVPDLNTRLLVKKLWDTFHVPVFTLVDADPHGIEIMCIYKYGSMSMSFEAHHLTVPAIRWLGLLPSDLKRLNVPKDSLIPLTKRDQMKLDSILRRPYVTCQPFWRKEMEIMADSKMKAEIQALTFLSSDYLSRVYLPNKLKFGGWI
Applicable Applications for anti-SPO11 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human SPO11, aa1-358 (NP_937998).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of SPO11 expression in transfected 293T cell line by SPO11 polyclonal antibody. Lane 1: SPO11 transfected lysate (39.38kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SPO11 expression in transfected 293T cell line by SPO11 polyclonal antibody. Lane 1: SPO11 transfected lysate (39.38kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-SPO11 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
44,537 Da
NCBI Official Full Name
SPO11
NCBI Official Synonym Full Names
SPO11 meiotic protein covalently bound to DSB
NCBI Official Symbol
SPO11
NCBI Official Synonym Symbols
CT35; TOPVIA; SPATA43
NCBI Protein Information
meiotic recombination protein SPO11; cancer/testis antigen 35; spermatogenesis associated 43; SPO11 meiotic protein covalently bound to DSB homolog
UniProt Protein Name
Meiotic recombination protein SPO11
Protein Family
UniProt Gene Name
SPO11
UniProt Synonym Gene Names
CT35
UniProt Entry Name
SPO11_HUMAN

NCBI Description

Meiotic recombination and chromosome segregation require the formation of double-strand breaks (DSBs) in paired chromosome homologs. During meiosis in yeast, a meiotic recombination protein is covalently-linked to the 5' end of DSBs and is essential for the formation of DSBs. The protein encoded by this gene is similar in sequence and conserved features to the yeast meiotic recombination protein. The encoded protein belongs to the TOP6A protein family. Several transcript variants encoding different isoforms have been found for this gene, but the full-length nature of only two of them have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

SPO11: Required for meiotic recombination. Mediates DNA cleavage that forms the double-strand breaks (DSB) that initiate meiotic recombination. Belongs to the TOP6A family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cancer Testis Antigen (CTA); Cell cycle regulation; Cell development/differentiation

Chromosomal Location of Human Ortholog: 20q13.31

Cellular Component: chromosome, telomeric region; nucleus

Molecular Function: DNA binding; hydrolase activity; ATP binding

Biological Process: male meiosis I; ovarian follicle development; meiotic recombination; synapsis; female gamete generation; spermatogenesis; DNA catabolic process, endonucleolytic; spermatid development

Research Articles on SPO11

Similar Products

Product Notes

The SPO11 spo11 (Catalog #AAA6000037) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SPO11 (Meiotic Recombination Protein SPO11, Cancer/testis Antigen 35, CT35) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SPO11 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the SPO11 spo11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAFAPMGPEA SFFDVLDRHR ESLLAALRRG GREPPTGGSR LASRFEDSVG LQMVSHCTTR KIKSDSPKSA QKFSLILKIL SMIYKLVQSN TYATKRDIYY TDSQLFGNQT VVDNIINDIS CMLKVSRRSL HILSTSKGLI AGNLRYIEED GTKVNCTCGA TAVAVPSNIQ GIRNLVTDAK FVLIVEKDAT FQRLLDDNFC NKLSPCIMIT GKGVPDLNTR LLVKKLWDTF HVPVFTLVDA DPHGIEIMCI YKYGSMSMSF EAHHLTVPAI RWLGLLPSDL KRLNVPKDSL IPLTKRDQMK LDSILRRPYV TCQPFWRKEM EIMADSKMKA EIQALTFLSS DYLSRVYLPN KLKFGGWI. It is sometimes possible for the material contained within the vial of "SPO11, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.