Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of SPN expression in transfected 293T cell line by SPN polyclonal antibody. Lane 1: SPN transfected lysate (40.3kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human SPN Polyclonal Antibody | anti-SPN antibody

SPN (Leukosialin, Galactoglycoprotein, GALGP, Leukocyte Sialoglycoprotein, Sialophorin, CD43) (AP)

Gene Names
SPN; LSN; CD43; GALGP; GPL115
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SPN; Polyclonal Antibody; SPN (Leukosialin; Galactoglycoprotein; GALGP; Leukocyte Sialoglycoprotein; Sialophorin; CD43) (AP); anti-SPN antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SPN.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-SPN antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human SPN, aa1-400 (NP_003114.1).
Immunogen Sequence
MATLLLLLGVLVVSPDALGSTTAVQTPTSGEPLVSTSEPLSSKMYTTSITSDPKADSTGDQTSALPPSTSINEGSPLWTSIGASTGSPLPEPTTYQEVSIKMSSVPQETPHATSHPAVPITANSLGSHTVTGGTITTNSPETSSRTSGAPVTTAASSLETSRGTSGPPLTMATVSLETSKGTSGPPVTMATDSLETSTGTTGPPVTMTTGSLEPSSGASGPQVSSVKLSTMMSPTTSTNASTVPFRNPDENSRGMLPVAVLVALLAVIVLVALLLLWRRRQKRRTGALVLSRGGKRNGVVDAWAGPAQVPEEGAVTVTVGGSGGDKGSGFPDGEGSSRRPTLTTFFGRRKSRQGSLAMEELKSGSGPSLKGEEEPLVASEDGAVDAPAPDEPEGGDGAAP
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of SPN expression in transfected 293T cell line by SPN polyclonal antibody. Lane 1: SPN transfected lysate (40.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SPN expression in transfected 293T cell line by SPN polyclonal antibody. Lane 1: SPN transfected lysate (40.3kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-SPN antibody
Sialophorin (leukosialin) is a major sialoglycoprotein on the surface of human T lymphocytes, monocytes, granulocytes, and some B lymphocytes, which appears to be important for immune function and may be part of a physiologic ligand-receptor complex involved in T-cell activation.
Product Categories/Family for anti-SPN antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40,322 Da
NCBI Official Full Name
leukosialin
NCBI Official Synonym Full Names
sialophorin
NCBI Official Symbol
SPN
NCBI Official Synonym Symbols
LSN; CD43; GALGP; GPL115
NCBI Protein Information
leukosialin; galactoglycoprotein; leukocyte sialoglycoprotein; sialophorin (gpL115, leukosialin, CD43)
UniProt Protein Name
Leukosialin
Protein Family
UniProt Gene Name
SPN
UniProt Synonym Gene Names
CD43; GALGP
UniProt Entry Name
LEUK_HUMAN

NCBI Description

The protein encoded by this gene is a major sialoglycoprotein found on the surface of thymocytes, T lymphocytes, monocytes, granulocytes, and some B lymphocytes. It may be part of a physiologic ligand-receptor complex involved in T-cell activation. During T-cell activation, this protein is actively removed from the T-cell-APC (antigen-presenting cell) contact site, suggesting a negative regulatory role in adaptive immune response. [provided by RefSeq, Sep 2011]

Uniprot Description

sialophorin: One of the major glycoproteins of thymocytes and T lymphocytes. Plays a role in the physicochemical properties of the T-cell surface and in lectin binding. Presents carbohydrate ligands to selectins. Has an extended rodlike structure that could protrude above the glycocalyx of the cell and allow multiple glycan chains to be accessible for binding. Is a counter-receptor for SN/Siglec-1. During T-cell activation is actively removed from the T-cell-APC (antigen-presenting cell) contact site thus suggesting a negative regulatory role in adaptive immune response. Interacts with HIPK2 via the cytoplasmic domain. Interacts with RDX. Cell surface of thymocytes, T-lymphocytes, neutrophils, plasma cells and myelomas.

Protein type: Membrane protein, integral; Cell surface

Chromosomal Location of Human Ortholog: 16p11.2

Cellular Component: extracellular space; cell surface; membrane; integral to plasma membrane; plasma membrane; basement membrane; uropod; external side of plasma membrane

Molecular Function: protein binding; transmembrane receptor activity

Biological Process: positive regulation of tumor necrosis factor biosynthetic process; regulation of defense response to virus; establishment and/or maintenance of cell polarity; negative regulation of cell adhesion; signal transduction; chemotaxis; negative thymic T cell selection; response to protozoan; negative regulation of T cell proliferation; cell surface receptor linked signal transduction; T cell costimulation; defense response to bacterium; cellular defense response; positive regulation of T cell proliferation; immune response; positive regulation of protein amino acid phosphorylation; negative regulation of type IV hypersensitivity; blood coagulation; leukocyte migration

Research Articles on SPN

Similar Products

Product Notes

The SPN spn (Catalog #AAA6394949) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SPN (Leukosialin, Galactoglycoprotein, GALGP, Leukocyte Sialoglycoprotein, Sialophorin, CD43) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SPN can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SPN spn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SPN, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.