Western Blot (WB)
(WB Suggested Anti-SPIRE2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Liver)
Rabbit SPIRE2 Polyclonal Antibody | anti-SPIRE2 antibody
SPIRE2 antibody - N-terminal region
Gene Names
SPIRE2; Spir-2
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SPIRE2; Polyclonal Antibody; SPIRE2 antibody - N-terminal region; anti-SPIRE2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EAQTVQSLGFAIYRALDWGLDESEERELSPQLERLIDLMANNDSEDSGCG
Sequence Length
714
Applicable Applications for anti-SPIRE2 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 86%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SPIRE2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-SPIRE2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Liver)
Western Blot (WB)
(WB Suggested Anti-SPIRE2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Liver)
Related Product Information for anti-SPIRE2 antibody
This is a rabbit polyclonal antibody against SPIRE2. It was validated on Western Blot
Target Description: SPIRE2 acts as a actin nucleation factor, remains associated with the slow-growing pointed end of the new filament. It is involved in vesicle transport processes providing a novel link between actin organization and intracellular transport .
Target Description: SPIRE2 acts as a actin nucleation factor, remains associated with the slow-growing pointed end of the new filament. It is involved in vesicle transport processes providing a novel link between actin organization and intracellular transport .
Product Categories/Family for anti-SPIRE2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
80kDa
NCBI Official Full Name
protein spire homolog 2
NCBI Official Synonym Full Names
spire type actin nucleation factor 2
NCBI Official Symbol
SPIRE2
NCBI Official Synonym Symbols
Spir-2
NCBI Protein Information
protein spire homolog 2
UniProt Protein Name
Protein spire homolog 2
Protein Family
UniProt Gene Name
SPIRE2
UniProt Synonym Gene Names
KIAA1832; SPIR2; Spir-2
UniProt Entry Name
SPIR2_HUMAN
Research Articles on SPIRE2
Similar Products
Product Notes
The SPIRE2 spire2 (Catalog #AAA3214768) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SPIRE2 antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SPIRE2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SPIRE2 spire2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EAQTVQSLGF AIYRALDWGL DESEERELSP QLERLIDLMA NNDSEDSGCG. It is sometimes possible for the material contained within the vial of "SPIRE2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
