Western Blot (WB)
(Western Blot detection against Immunogen (36.74kD).)
Mouse anti-Human LGALS4 Monoclonal Antibody | anti-LGALS4 antibody
LGALS4 (Galectin-4, Gal-4, Antigen NY-CO-27, L-36 Lactose-binding Protein, L36LBP, Lactose-binding Lectin 4) (PE)
Gene Names
LGALS4; GAL4; L36LBP
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
LGALS4; Monoclonal Antibody; LGALS4 (Galectin-4; Gal-4; Antigen NY-CO-27; L-36 Lactose-binding Protein; L36LBP; Lactose-binding Lectin 4) (PE); anti-LGALS4 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1E8
Specificity
Recognizes human LGALS4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-LGALS4 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa51-150 from human LGALS4 (NP_006140) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFI
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (36.74kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (36.74kD).)
Immunohistochemistry (IHC)
(Immunoperoxidase of monoclonal antibody to LGALS4 on formalin-fixed paraffin-embedded human ovary cancer. [antibody concentration 3ug/ml])
Immunohistochemistry (IHC)
(Immunoperoxidase of monoclonal antibody to LGALS4 on formalin-fixed paraffin-embedded human ovary cancer. [antibody concentration 3ug/ml])
Product Categories/Family for anti-LGALS4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38.1 kDa (343aa), confirmed by MALDI-TOF.
NCBI Official Full Name
galectin-4
NCBI Official Synonym Full Names
galectin 4
NCBI Official Symbol
LGALS4
NCBI Official Synonym Symbols
GAL4; L36LBP
NCBI Protein Information
galectin-4
UniProt Protein Name
Galectin-4
Protein Family
UniProt Gene Name
LGALS4
UniProt Synonym Gene Names
Gal-4; L36LBP
UniProt Entry Name
LEG4_HUMAN
NCBI Description
The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. The expression of this gene is restricted to small intestine, colon, and rectum, and it is underexpressed in colorectal cancer. [provided by RefSeq, Jul 2008]
Uniprot Description
galectin-4: Galectin that binds lactose and a related range of sugars. May be involved in the assembly of adherens junctions.
Chromosomal Location of Human Ortholog: 19q13.2
Cellular Component: plasma membrane; cytosol
Molecular Function: carbohydrate binding
Biological Process: cell adhesion
Research Articles on LGALS4
Similar Products
Product Notes
The LGALS4 lgals4 (Catalog #AAA6158604) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The LGALS4 (Galectin-4, Gal-4, Antigen NY-CO-27, L-36 Lactose-binding Protein, L36LBP, Lactose-binding Lectin 4) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LGALS4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LGALS4 lgals4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LGALS4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
