Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SPINK1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: MCF7 cell lysate)

Rabbit SPINK1 Polyclonal Antibody | anti-SPINK1 antibody

SPINK1 antibody - N-terminal region

Gene Names
SPINK1; TCP; PCTT; PSTI; TATI; Spink3
Reactivity
Human, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SPINK1; Polyclonal Antibody; SPINK1 antibody - N-terminal region; anti-SPINK1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KVTGIFLLSALALLSLSGNTGADSLGREAKCYNELNGCTKIYDPVCGTDG
Sequence Length
79
Applicable Applications for anti-SPINK1 antibody
Western Blot (WB)
Homology
Human: 100%; Rabbit: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SPINK1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SPINK1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: MCF7 cell lysate)

Western Blot (WB) (WB Suggested Anti-SPINK1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: MCF7 cell lysate)
Related Product Information for anti-SPINK1 antibody
This is a rabbit polyclonal antibody against SPINK1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SPINK1 is a trypsin inhibitor, which is secreted from pancreatic acinar cells into pancreatic juice. It is thought to function in the prevention of trypsin-catalyzed premature activation of zymogens within the pancreas and the pancreatic duct. Mutations in this gene are associated with hereditary pancreatitis and tropical calcific pancreatitis.
Product Categories/Family for anti-SPINK1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
8kDa
NCBI Official Full Name
serine protease inhibitor Kazal-type 1
NCBI Official Synonym Full Names
serine peptidase inhibitor, Kazal type 1
NCBI Official Symbol
SPINK1
NCBI Official Synonym Symbols
TCP; PCTT; PSTI; TATI; Spink3
NCBI Protein Information
serine protease inhibitor Kazal-type 1
UniProt Protein Name
Pancreatic secretory trypsin inhibitor
Protein Family
UniProt Gene Name
SPINK1
UniProt Synonym Gene Names
PSTI; TATI
UniProt Entry Name
ISK1_HUMAN

NCBI Description

The protein encoded by this gene is a trypsin inhibitor, which is secreted from pancreatic acinar cells into pancreatic juice. It is thought to function in the prevention of trypsin-catalyzed premature activation of zymogens within the pancreas and the pancreatic duct. Mutations in this gene are associated with hereditary pancreatitis and tropical calcific pancreatitis. [provided by RefSeq, Oct 2008]

Uniprot Description

SPINK1: This is a trypsin inhibitor, its physiological function is to prevent the trypsin-catalyzed premature activation of zymogens within the pancreas. Defects in SPINK1 are a cause of pancreatitis (PCTT). A disease characterized by the presence of calculi in pancreatic ducts. It causes severe abdominal pain attacks. Defects in SPINK1 are the cause of susceptibility to tropical calcific pancreatitis (TCP). TCP is an idiopathic, juvenile, nonalcoholic form of chronic pancreatitis widely prevalent in several tropical countries. It can be associated with fibrocalculous pancreatic diabetes (FCPD) depending on both environmental and genetic factors. TCP differs from alcoholic pancreatitis by a much younger age of onset, pancreatic calcification, a high incidence of insulin dependent but ketosis resistant diabetes mellitus, and an exceptionally high incidence of pancreatic cancer.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 5q32

Cellular Component: extracellular space

Molecular Function: serine-type endopeptidase inhibitor activity; protein binding; endopeptidase inhibitor activity

Biological Process: negative regulation of peptidyl-tyrosine phosphorylation; regulation of acrosome reaction

Disease: Tropical Calcific Pancreatitis; Pancreatitis, Hereditary

Research Articles on SPINK1

Similar Products

Product Notes

The SPINK1 spink1 (Catalog #AAA3201761) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SPINK1 antibody - N-terminal region reacts with Human, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's SPINK1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SPINK1 spink1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KVTGIFLLSA LALLSLSGNT GADSLGREAK CYNELNGCTK IYDPVCGTDG. It is sometimes possible for the material contained within the vial of "SPINK1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.