Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit Spike Protein (SARS-CoV) Polyclonal Antibody | anti-SARS-CoV antibody

Anti-Spike Protein (SARS-CoV) Polyclonal Antibody

Applications
Western Blot, ELISA
Purity
Protein G/A immunoaffinity chromatography
Synonyms
Spike Protein (SARS-CoV); Polyclonal Antibody; Anti-Spike Protein (SARS-CoV) Polyclonal Antibody; Polyclonal antibody for SARS-CoV spike protein; anti-SARS-CoV antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Isotype
IgG
Specificity
Reacts with spike protein of SARS-CoV. Cross-reacts to most spike proteins from other subtypes of SARS-CoV
Purity/Purification
Protein G/A immunoaffinity chromatography
Form/Format
In PBS
Concentration
2ug/ul (varies by lot)
Applicable Applications for anti-SARS-CoV antibody
Western Blot (WB), ELISA (EIA)
Application Notes
Western blot (1:100-1:1000) and ELISA, May be used for other applications
Immunogen
A peptide sequence (amino acid 19-48) derived from Spike (S) protein of SARS-CoV (Gene Accession#: AY278488): CTTFDDVQAPNYTQHTSSMRGVYYPDEIFR
Preparation and Storage
Store at -20 degree C; Stable for 6-months from the date of shipment when kept at 4 degree C. Non-hazardous. No MSDS required.
Related Product Information for anti-SARS-CoV antibody
SARS coronavirus is a positive and single stranded RNA (29.7 kb) virus belonging to a family of enveloped coronaviruses. SARS virus has 13 known genes and encodes 14 known proteins, including ORF1a polyprotein, ORF1b polyprotein, nucleocapsid protein, spike protein, membrane protein, envelope protein, and eight accessory proteins.

Similar Products

Product Notes

The SARS-CoV (Catalog #AAA434244) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Spike Protein (SARS-CoV) can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), ELISA (EIA). Western blot (1:100-1:1000) and ELISA, May be used for other applications. Researchers should empirically determine the suitability of the SARS-CoV for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Spike Protein (SARS-CoV), Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.