Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Anti- SP2 Picoband antibody, MBS178095, Western blottingAll lanes: Anti SP2 (MBS178095) at 0.5ug/mlLane 1: Rat Lung Tissue Lysate at 50ugLane 2: A549 Whole Cell Lysate at 40ugLane 3: HELA Whole Cell Lysate at 40ugPredicted bind size: 72KDObserved bind size: 72KD )

anti-Human, Rat SP2 Polyclonal Antibody | anti-SP2 antibody

Anti-SP2 Antibody

Reactivity
Human, Rat
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
SP2; Polyclonal Antibody; Anti-SP2 Antibody; Transcription factor Sp2; Kiaa0048; OTTHUMP00000196580; SP2_HUMAN; SPECIFICITY PROTEIN 2; Sp2 transcription factor; anti-SP2 antibody
Ordering
For Research Use Only!
Reactivity
Human, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
613
Applicable Applications for anti-SP2 antibody
Western Blot (WB)
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human SP2 (312-343aa QVVQIPQQALRVVQAASATLPTVPQKPSQNFQ), identical to the related mouse sequence.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- SP2 Picoband antibody, MBS178095, Western blottingAll lanes: Anti SP2 (MBS178095) at 0.5ug/mlLane 1: Rat Lung Tissue Lysate at 50ugLane 2: A549 Whole Cell Lysate at 40ugLane 3: HELA Whole Cell Lysate at 40ugPredicted bind size: 72KDObserved bind size: 72KD )

Western Blot (WB) (Anti- SP2 Picoband antibody, MBS178095, Western blottingAll lanes: Anti SP2 (MBS178095) at 0.5ug/mlLane 1: Rat Lung Tissue Lysate at 50ugLane 2: A549 Whole Cell Lysate at 40ugLane 3: HELA Whole Cell Lysate at 40ugPredicted bind size: 72KDObserved bind size: 72KD )
Related Product Information for anti-SP2 antibody
Description: Rabbit IgG polyclonal antibody for Transcription factor Sp2(SP2) detection. Tested with WB in Human;Rat.

Background: Transcription factor Sp2 is a protein that in humans is encoded by the SP2 gene. This gene encodes a member of the Sp subfamily of Sp/XKLF transcription factors. Sp family proteins are sequence-specific DNA-binding proteins characterized by an amino-terminal trans-activation domain and three carboxy-terminal zinc finger motifs. This protein contains the least conserved DNA-binding domain within the Sp subfamily of proteins, and its DNA sequence specificity differs from the other Sp proteins. It localizes primarily within subnuclear foci associated with the nuclear matrix, and can activate or in some cases repress expression from different promoters.
References
1. Kingsley C, Winoto A (Oct 1992). "Cloning of GT box-binding proteins: a novel Sp1 multigene family regulating T-cell receptor gene expression". Mol Cell Biol 12 (10): 4251-61. 2. Rotheneder H, Geymayer S, Haidweger E (Nov 1999). "Transcription factors of the Sp1 family: interaction with E2F and regulation of the murine thymidine kinase promoter". J. Mol. Biol. 293 (5): 1005-15. 3. Scohy S, Van Vooren P, Szpirer C, Szpirer J (Oct 1998). "Assignment1 of Sp genes to rat chromosome bands 7q36 (Sp1), 10q31-->q32.1 (Sp2), 3q24-->q31 (Sp3) and 6q33 (Sp4) and of the SP2 gene to human chromosome bands 17q21.3-->q22 by in situ hybridization". Cytogenet Cell Genet 81 (3-4): 273-4.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64,153 Da
NCBI Official Full Name
transcription factor Sp2
NCBI Official Synonym Full Names
Sp2 transcription factor
NCBI Official Symbol
SP2
NCBI Protein Information
transcription factor Sp2
UniProt Protein Name
Transcription factor Sp2
UniProt Gene Name
SP2
UniProt Synonym Gene Names
KIAA0048
UniProt Entry Name
SP2_HUMAN

NCBI Description

This gene encodes a member of the Sp subfamily of Sp/XKLF transcription factors. Sp family proteins are sequence-specific DNA-binding proteins characterized by an amino-terminal trans-activation domain and three carboxy-terminal zinc finger motifs. This protein contains the least conserved DNA-binding domain within the Sp subfamily of proteins, and its DNA sequence specificity differs from the other Sp proteins. It localizes primarily within subnuclear foci associated with the nuclear matrix, and can activate or in some cases repress expression from different promoters. [provided by RefSeq, Jul 2008]

Uniprot Description

SP2: Binds to GC box promoters elements and selectively activates mRNA synthesis from genes that contain functional recognition sites. Belongs to the Sp1 C2H2-type zinc-finger protein family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor; DNA-binding; C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 17q21.32

Cellular Component: nucleus

Molecular Function: DNA binding; histone deacetylase binding; metal ion binding; protein binding

Biological Process: immune response; multicellular organism growth; regulation of transcription from RNA polymerase II promoter; transcription, DNA-dependent

Research Articles on SP2

Similar Products

Product Notes

The SP2 sp2 (Catalog #AAA178095) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-SP2 Antibody reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SP2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot Concentration: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the SP2 sp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.