Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Flow Cytometry (FC/FACS) (Researcher: Dr. Ade Kallas, University of tartuApplication: Flow CytometrySpecies + Tissue/Cell type: A. Human H9 cells and B. Human H9 cells+Na+ButyratePrimary antibody dilution: 2ug+1x106 cellsSecondary antibody: Chicken anti rabbit-Alexa Fluor 488Secondary antibody dilution: 1:1000)

Rabbit SOX9 Polyclonal Antibody | anti-SOX9 antibody

SOX9 antibody - C-terminal region

Gene Names
SOX9; CMD1; SRA1; CMPD1; SRXX2; SRXY10
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot, Flow Cytometry, Functional Assay
Purity
Affinity Purified
Synonyms
SOX9; Polyclonal Antibody; SOX9 antibody - C-terminal region; anti-SOX9 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQ
Sequence Length
509
Applicable Applications for anti-SOX9 antibody
Western Blot (WB), Flow Cytometry (FC/FACS)
Homology
Cow: 86%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human SOX9
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Flow Cytometry (FC/FACS)

(Researcher: Dr. Ade Kallas, University of tartuApplication: Flow CytometrySpecies + Tissue/Cell type: A. Human H9 cells and B. Human H9 cells+Na+ButyratePrimary antibody dilution: 2ug+1x106 cellsSecondary antibody: Chicken anti rabbit-Alexa Fluor 488Secondary antibody dilution: 1:1000)

Flow Cytometry (FC/FACS) (Researcher: Dr. Ade Kallas, University of tartuApplication: Flow CytometrySpecies + Tissue/Cell type: A. Human H9 cells and B. Human H9 cells+Na+ButyratePrimary antibody dilution: 2ug+1x106 cellsSecondary antibody: Chicken anti rabbit-Alexa Fluor 488Secondary antibody dilution: 1:1000)

Western Blot (WB)

(Host: RabbitTarget Name: SOX10Sample Tissue: Rat BrainAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SOX10Sample Tissue: Rat BrainAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: SOX9Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SOX9Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RatTarget Name: SOX10Sample Tissue: Rat BrainAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RatTarget Name: SOX10Sample Tissue: Rat BrainAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-SOX9 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysate)

Western Blot (WB) (WB Suggested Anti-SOX9 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysate)
Related Product Information for anti-SOX9 antibody
This is a rabbit polyclonal antibody against SOX9. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SOX9 recognizes the sequence CCTTGAG along with other members of the HMG-box class DNA-binding proteins. It acts during chondrocyte differentiation and, with steroidogenic factor 1, regulates transcription of the anti-Muellerian hormone (AMH) gene. Deficiencies lead to the skeletal malformation syndrome campomelic dysplasia, frequently with sex reversal.The protein encoded by this gene recognizes the sequence CCTTGAG along with other members of the HMG-box class DNA-binding proteins. It acts during chondrocyte differentiation and, with steroidogenic factor 1, regulates transcription of the anti-Muellerian hormone (AMH) gene. Deficiencies lead to the skeletal malformation syndrome campomelic dysplasia, frequently with sex reversal. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
transcription factor SOX-9
NCBI Official Synonym Full Names
SRY-box 9
NCBI Official Symbol
SOX9
NCBI Official Synonym Symbols
CMD1; SRA1; CMPD1; SRXX2; SRXY10
NCBI Protein Information
transcription factor SOX-9
UniProt Protein Name
Transcription factor SOX-9
Protein Family
UniProt Gene Name
SOX9
UniProt Entry Name
SOX9_HUMAN

NCBI Description

The protein encoded by this gene recognizes the sequence CCTTGAG along with other members of the HMG-box class DNA-binding proteins. It acts during chondrocyte differentiation and, with steroidogenic factor 1, regulates transcription of the anti-Muellerian hormone (AMH) gene. Deficiencies lead to the skeletal malformation syndrome campomelic dysplasia, frequently with sex reversal. [provided by RefSeq, Jul 2008]

Uniprot Description

SOX9: Plays an important role in the normal skeletal development. May regulate the expression of other genes involved in chondrogenesis by acting as a transcription factor for these genes. Defects in SOX9 are the cause of campomelic dysplasia (CMD1). CMD1 is a rare, often lethal, dominantly inherited, congenital osteochondrodysplasia, associated with male- to-female autosomal sex reversal in two-thirds of the affected karyotypic males. A disease of the newborn characterized by congenital bowing and angulation of long bones, unusually small scapulae, deformed pelvis and spine and a missing pair of ribs. Craniofacial defects such as cleft palate, micrognatia, flat face and hypertelorism are common. Various defects of the ear are often evident, affecting the cochlea, malleus incus, stapes and tympanum. Most patients die soon after birth due to respiratory distress which has been attributed to hypoplasia of the tracheobronchial cartilage and small thoracic cage. Defects in SOX9 are the cause of 46,XX sex reversal type 2 (SRXX2). SRXX2 is a condition in which male gonads develop in a genetic female (female to male sex reversal).

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 17q24.3

Cellular Component: nucleoplasm; protein complex; nucleus

Molecular Function: RNA polymerase II transcription factor activity, enhancer binding; protein binding; protein heterodimerization activity; bHLH transcription factor binding; beta-catenin binding; chromatin binding; transcription factor activity; protein kinase activity

Biological Process: prostate gland development; extracellular matrix organization and biogenesis; somatic stem cell maintenance; positive regulation of transcription, DNA-dependent; astrocyte fate commitment; negative regulation of chondrocyte differentiation; negative regulation of epithelial cell differentiation; notochord development; protein amino acid phosphorylation; regulation of apoptosis; negative regulation of bone mineralization; cell-cell adhesion; hair follicle development; positive regulation of mesenchymal cell proliferation; tissue homeostasis; negative regulation of ossification; oligodendrocyte differentiation; positive regulation of epithelial cell differentiation; protein complex assembly; cartilage condensation; negative regulation of photoreceptor cell differentiation; positive regulation of phosphoinositide 3-kinase cascade; nucleosome assembly; positive regulation of chondrocyte differentiation; retina development in camera-type eye; positive regulation of protein catabolic process; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; positive regulation of epithelial cell proliferation; negative regulation of apoptosis; transcription from RNA polymerase II promoter; neural crest cell development; Sertoli cell differentiation; cell fate specification; negative regulation of immune system process; signal transduction; cAMP-mediated signaling; mammary gland development; positive regulation of cell proliferation; protein kinase B signaling cascade; otic vesicle formation; skeletal development; negative regulation of epithelial cell proliferation; regulation of cell adhesion; epidermal growth factor receptor signaling pathway; ossification; male gonad development; cytoskeleton organization and biogenesis; Sertoli cell development; endocrine pancreas development; regulation of cell proliferation; male germ-line sex determination; chromatin remodeling; limb bud formation; ureteric bud branching; cartilage development; epithelial to mesenchymal transition; spermatogenesis; positive regulation of protein amino acid phosphorylation; negative regulation of myoblast differentiation

Disease: Campomelic Dysplasia; 46,xy Sex Reversal 10

Research Articles on SOX9

Similar Products

Product Notes

The SOX9 sox9 (Catalog #AAA3203839) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SOX9 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SOX9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Flow Cytometry (FC/FACS). Researchers should empirically determine the suitability of the SOX9 sox9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AGQGTGLYST FTYMNPAQRP MYTPIADTSG VPSIPQTHSP QHWEQPVYTQ. It is sometimes possible for the material contained within the vial of "SOX9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.