Rabbit SOX10 Polyclonal Antibody | anti-SOX10 antibody

SOX10 Antibody - middle region

Cat. Num. AAA3201449

• Gene Names: SOX10; DOM; WS4; PCWH; WS2E; WS4C
• Reactivity: Reactivity: Human; Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
• Applications: Immunohistochemistry, Western Blot
• Purity: Affinity Purified
• Synonyms: SOX10; Polyclonal Antibody; SOX10 Antibody - middle region; anti-SOX10 antibody

• Host: Rabbit
• Reactivity: Reactivity: Human; Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: PGGEAEQGGTAAIQAHYKSAHLDHRHPGEGSPMSDGNPEHPSGQSHGPPT
• Sequence Length: 466

• Applicable Applications for anti-SOX10 antibody: Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: Blocking Peptide: please indquire
• Homology: Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 86%
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SOX10
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Sample Type: human optic nerves and spinal cordA/[IHC-PZ] (optimal processing)human optic nerve (short post mortem interval) fixed by immersion in zinc-based fixative (BD Pharmingen 552658), processed to minimize antigen loss (shortened protocol, reduced exposure to high temperature); embedded in paraffin wax; sectioned at 3 micronsA2/[IHC-PZ + FF]As above for initial fixation then post-fixed in 10% buffered formalin for 5 daysB/ [IHC-P]human optic nerve and spinal cord fixed in 10% buffered formalin (relatively short post mortem interval and fixation duration); standard processing; embedded in paraffin wax; sectioned at 3 micronsControlsNegative: omission of primary.Positive: Olig2 reactivity was in comparison with antibody from Prof Charles Stiles/ Dr John Alberta (DF308; N terminal Olig2) used at 1:10000 (IHC-PZ); 1:4000 (IHC-P))

Immunohistochemistry (IHC)

(Immunohistochemistry with Kidney lysate tissue at an antibody concentration of 4-8ug/ml using anti-SOX10 antibody )

Immunohistochemistry (IHC)

(Immunohistochemistry with Skin tissue at an antibody concentration of 4-8ug/ml using anti-SOX10 antibody )

Western Blot (WB)

(Host: RabbitTarget Name: SOX10Sample Tissue: Human MCF7 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: SOX10Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 0.5ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: SOX10Sample Type: Jurkat cell lysatesLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 2.5ug/mlPeptide Concentration: 4.0ug/mlLysate Quantity: 25ug/laneGel Concentration: 12%)

Western Blot (WB)

(SOX10 antibody - middle region validated by WB using Hek 293 Whole Cell Lysate at 1:4,000.)

Western Blot (WB)

(WB Suggested Anti-SOX10Antibody Titration: .25ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)

Western Blot (WB)

(Western Blot (WB)Host: RabbitTarget: SOX10Positive control (+): Rat brain (R-BR)Negative control (-): Mouse intestine (M-IN) Antibody concentration: 1ug/ml)

Related Product Information for anti-SOX10 antibody

SOX10 is a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. This protein may act as a transcriptional activator after forming a protein complex with other proteins. It acts as a nucleocytoplasmic shuttle protein and is important for neural crest and peripheral nervous system development. Mutations in this gene are associated with Waardenburg-Shah and Waardenburg-Hirschsprung disease.

Product Categories/Family for anti-SOX10 antibody

Polyclonal; Transcription Factor; Transcription Regulation; Transcription Regulation; Cell Biology; Chromatin & Nuclear Signaling; Developmental Biology; Immunology; Disease Related; Immunohistochemistry; Cell Structure; Transcription Factors; Cell Differ

NCBI and Uniprot Product Information

• NCBI GI #: 5902104
• NCBI GeneID: 6663
• NCBI Accession #: NP_008872
• NCBI GenBank Nucleotide #: NM_006941
• UniProt Accession #: P56693
• Molecular Weight: 50kDa
• NCBI Official Full Name: transcription factor SOX-10
• NCBI Official Synonym Full Names: SRY-box 10
• NCBI Official Symbol: SOX10
• NCBI Official Synonym Symbols: DOM; WS4; PCWH; WS2E; WS4C
• NCBI Protein Information: transcription factor SOX-10
• UniProt Protein Name: Transcription factor SOX-10
• Protein Family: Transcription factor
• UniProt Gene Name: SOX10

NCBI Description

This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional activator after forming a protein complex with other proteins. This protein acts as a nucleocytoplasmic shuttle protein and is important for neural crest and peripheral nervous system development. Mutations in this gene are associated with Waardenburg-Shah and Waardenburg-Hirschsprung disease. [provided by RefSeq, Jul 2008]

Uniprot Description

SOX10: Transcription factor that seems to function synergistically with the POU domain protein TST-1/OCT6/SCIP. Could confer cell specificity to the function of other transcription factors in developing and mature glia. Defects in SOX10 are the cause of Waardenburg syndrome type 2E (WS2E). WS2 is a genetically heterogeneous, autosomal dominant disorder characterized by sensorineural deafness, pigmentary disturbances, and absence of dystopia canthorum. The frequency of deafness is higher in WS2 than in WS1. Defects in SOX10 are a cause of Waardenburg syndrome type 4C (WS4C); also known as Waardenburg-Shah syndrome. WS4C is characterized by the association of Waardenburg features (depigmentation and deafness) and the absence of enteric ganglia in the distal part of the intestine (Hirschsprung disease). Defects in SOX10 are the cause of peripheral demyelinating neuropathy, central dysmyelinating leukodystrophy, Waardenburg syndrome, and Hirschsprung disease (PCWH); also called neurologic variant of Waardenburg-Shah syndrome. PCWH is a rare, complex and more severe neurocristopathy that includes features of 4 distinct syndromes: peripheral demyelinating neuropathy, central dysmyelinating leukodystrophy, Waardenburg syndrome, and Hirschsprung disease.

Protein type: Cell development/differentiation; DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 22q13.1

Cellular Component: nucleoplasm; nucleus

Molecular Function: identical protein binding; protein binding; transcription coactivator activity

Biological Process: anatomical structure morphogenesis; regulation of transcription from RNA polymerase II promoter

Disease: Peripheral Demyelinating Neuropathy, Central Dysmyelination, Waardenburg Syndrome, And Hirschsprung Disease; Waardenburg Syndrome, Type 2e; Waardenburg Syndrome, Type 4c