Rabbit anti-Human, Mouse SOCS2 Polyclonal Antibody | anti-SOCS2 antibody
SOCS2 Rabbit pAb
Gene Names
SOCS2; CIS2; SSI2; Cish2; SSI-2; SOCS-2; STATI2
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity purification
Synonyms
SOCS2; Polyclonal Antibody; SOCS2 Rabbit pAb; CIS2; Cish2; SOCS-2; SSI-2; SSI2; STATI2; anti-SOCS2 antibody
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MTLRCLEPSGNGGEGTRSQWGTAGSAEEPSPQAARLAKALRELGQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLKDYLEEYKFQV
Applicable Applications for anti-SOCS2 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-198 of human SOCS2 (NP_001257400.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Related Product Information for anti-SOCS2 antibody
Background: This gene encodes a member of the suppressor of cytokine signaling (SOCS) family. SOCS family members are cytokine-inducible negative regulators of cytokine receptor signaling via the Janus kinase/signal transducer and activation of transcription pathway (the JAK/STAT pathway). SOCS family proteins interact with major molecules of signaling complexes to block further signal transduction, in part, by proteasomal depletion of receptors or signal-transducing proteins via ubiquitination. The expression of this gene can be induced by a subset of cytokines, including erythropoietin, GM-CSF, IL10, interferon (IFN)-gamma and by cytokine receptors such as growth horomone receptor. The protein encoded by this gene interacts with the cytoplasmic domain of insulin-like growth factor-1 receptor (IGF1R) and is thought to be involved in the regulation of IGF1R mediated cell signaling. This gene has pseudogenes on chromosomes 20 and 22. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-SOCS2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
198
NCBI Official Full Name
suppressor of cytokine signaling 2
NCBI Official Synonym Full Names
suppressor of cytokine signaling 2
NCBI Official Symbol
SOCS2
NCBI Official Synonym Symbols
CIS2; SSI2; Cish2; SSI-2; SOCS-2; STATI2
NCBI Protein Information
suppressor of cytokine signaling 2; CIS-2; STAT induced STAT inhibitor-2; STAT-induced STAT inhibitor 2; STAT-induced STAT inhibitor-2; cytokine-inducible SH2 protein 2; suppressor of cytokine signaling-2
UniProt Protein Name
Suppressor of cytokine signaling 2
Protein Family
UniProt Gene Name
SOCS2
UniProt Synonym Gene Names
CIS2; SSI2; STATI2; SOCS-2; CIS-2; SSI-2
UniProt Entry Name
SOCS2_HUMAN
Similar Products
Product Notes
The SOCS2 socs2 (Catalog #AAA9142585) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SOCS2 Rabbit pAb reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's SOCS2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the SOCS2 socs2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MTLRCLEPSG NGGEGTRSQW GTAGSAEEPS PQAARLAKAL RELGQTGWYW GSMTVNEAKE KLKEAPEGTF LIRDSSHSDY LLTISVKTSA GPTNLRIEYQ DGKFRLDSII CVKSKLKQFD SVVHLIDYYV QMCKDKRTGP EAPRNGTVHL YLTKPLYTSA PSLQHLCRLT INKCTGAIWG LPLPTRLKDY LEEYKFQV. It is sometimes possible for the material contained within the vial of "SOCS2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
