Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SNAPC3 Antibody Titration: 2.5ug/mlELISA Titer: 1:1562500Positive Control: Human Small Intestine)

Rabbit SNAPC3 Polyclonal Antibody | anti-SNAPC3 antibody

SNAPC3 antibody - N-terminal region

Gene Names
SNAPC3; SNAP50; PTFbeta
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
SNAPC3; Polyclonal Antibody; SNAPC3 antibody - N-terminal region; anti-SNAPC3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CSGVGGRQDPVSGSGGCNFPEYELPELNTRAFHVGAFGELWRGRLRGAGD
Sequence Length
411
Applicable Applications for anti-SNAPC3 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 86%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SNAPC3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SNAPC3 Antibody Titration: 2.5ug/mlELISA Titer: 1:1562500Positive Control: Human Small Intestine)

Western Blot (WB) (WB Suggested Anti-SNAPC3 Antibody Titration: 2.5ug/mlELISA Titer: 1:1562500Positive Control: Human Small Intestine)
Related Product Information for anti-SNAPC3 antibody
This is a rabbit polyclonal antibody against SNAPC3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SNAPC3 is part of the SNAPc complex required for the transcription of both RNA polymerase II and III small-nuclear RNA genes. SNAPC3 binds to the proximal sequence element (PSE), a non-TATA-box basal promoter element common to these 2 types of genes. SNAPC3 recruits TBP and BRF2 to the U6 snRNA TATA box.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
snRNA-activating protein complex subunit 3
NCBI Official Synonym Full Names
small nuclear RNA activating complex polypeptide 3
NCBI Official Symbol
SNAPC3
NCBI Official Synonym Symbols
SNAP50; PTFbeta
NCBI Protein Information
snRNA-activating protein complex subunit 3
UniProt Protein Name
snRNA-activating protein complex subunit 3
UniProt Gene Name
SNAPC3
UniProt Synonym Gene Names
SNAP50; SNAPc subunit 3; PSE-binding factor subunit beta; PTF subunit beta
UniProt Entry Name
SNPC3_HUMAN

Uniprot Description

SNAPC3: Part of the SNAPc complex required for the transcription of both RNA polymerase II and III small-nuclear RNA genes. Binds to the proximal sequence element (PSE), a non-TATA-box basal promoter element common to these 2 types of genes. Recruits TBP and BRF2 to the U6 snRNA TATA box.

Protein type: Transcription factor

Chromosomal Location of Human Ortholog: 9p22.3

Cellular Component: nucleoplasm; nucleolus; nucleus

Molecular Function: DNA binding

Biological Process: transcription from RNA polymerase II promoter; transcription from RNA polymerase III promoter; regulation of transcription, DNA-dependent; snRNA transcription; gene expression

Research Articles on SNAPC3

Similar Products

Product Notes

The SNAPC3 snapc3 (Catalog #AAA3201904) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SNAPC3 antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SNAPC3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SNAPC3 snapc3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CSGVGGRQDP VSGSGGCNFP EYELPELNTR AFHVGAFGEL WRGRLRGAGD. It is sometimes possible for the material contained within the vial of "SNAPC3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.