Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human kidney )

Rabbit SNAI2 Polyclonal Antibody | anti-SNAI2 antibody

SNAI2 antibody - middle region

Gene Names
SNAI2; SLUG; WS2D; SLUGH; SLUGH1; SNAIL2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
SNAI2; Polyclonal Antibody; SNAI2 antibody - middle region; anti-SNAI2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SDTSSKDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTFS
Sequence Length
268
Applicable Applications for anti-SNAI2 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Yeast: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SNAI2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human kidney )

Immunohistochemistry (IHC) (Human kidney )

Immunohistochemistry (IHC)

(Testis)

Immunohistochemistry (IHC) (Testis)

Western Blot (WB)

(Host: RabbitTarget Name: SNAI2Sample Tissue: Human JurkatAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SNAI2Sample Tissue: Human JurkatAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-SNAI2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Transfected 293T)

Western Blot (WB) (WB Suggested Anti-SNAI2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Transfected 293T)
Related Product Information for anti-SNAI2 antibody
This is a rabbit polyclonal antibody against SNAI2. It was validated on Western Blot and immunohistochemistry

Target Description: SNAI2 is a member of the Snail family of C2H2-type zinc finger transcription factors. The protein acts as a transcriptional repressor that binds to E-box motifs and is also likely to repress E-cadherin transcription in breast carcinoma. This protein is involved in epithelial-mesenchymal transitions and has antiapoptotic activity. Mutations in this gene may be associated with sporatic cases of neural tube defects. This gene encodes a member of the Snail family of C2H2-type zinc finger transcription factors. The encoded protein acts as a transcriptional repressor that binds to E-box motifs and is also likely to repress E-cadherin transcription in breast carcinoma. This protein is involved in epithelial-mesenchymal transitions and has antiapoptotic activity. Mutations in this gene may be associated with sporatic cases of neural tube defects. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30kDa
NCBI Official Full Name
zinc finger protein SNAI2
NCBI Official Synonym Full Names
snail family transcriptional repressor 2
NCBI Official Symbol
SNAI2
NCBI Official Synonym Symbols
SLUG; WS2D; SLUGH; SLUGH1; SNAIL2
NCBI Protein Information
zinc finger protein SNAI2
UniProt Protein Name
Zinc finger protein SNAI2
Protein Family
UniProt Gene Name
SNAI2
UniProt Synonym Gene Names
SLUG; SLUGH
UniProt Entry Name
SNAI2_HUMAN

NCBI Description

This gene encodes a member of the Snail family of C2H2-type zinc finger transcription factors. The encoded protein acts as a transcriptional repressor that binds to E-box motifs and is also likely to repress E-cadherin transcription in breast carcinoma. This protein is involved in epithelial-mesenchymal transitions and has antiapoptotic activity. Mutations in this gene may be associated with sporatic cases of neural tube defects. [provided by RefSeq, Jul 2008]

Uniprot Description

Snail2: Transcriptional repressor. Involved in the generation and migration of neural crest cells. Plays a role in mediating RAF1-induced transcriptional repression of the TJ protein, occludin (OCLN) and subsequent oncogenic transformation of epithelial cells. Interacts (via SNAG domain) with LIMD1 (via LIM domains), WTIP (via LIM domains) and AJUBA (via LIM domains). Expressed in placenta and adult heart, pancreas, liver, kidney and skeletal muscle. Belongs to the snail C2H2-type zinc-finger protein family.

Protein type: C2H2-type zinc finger protein; Transcription factor; Apoptosis; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 8q11

Cellular Component: cytoplasm; nuclear chromatin; nucleus

Molecular Function: RNA polymerase II transcription factor activity, enhancer binding; sequence-specific DNA binding; metal ion binding; chromatin binding

Biological Process: transcription from RNA polymerase II promoter; substrate-bound cell migration, cell release from substrate; Notch signaling pathway; neural crest cell development; regulation of osteoblast differentiation; negative regulation of chondrocyte differentiation; palate development; negative regulation of transcription from RNA polymerase II promoter; Wnt receptor signaling pathway through beta-catenin; osteoblast differentiation; negative regulation of DNA damage response, signal transduction by p53 class mediator; sensory perception of sound; pigmentation; white fat cell differentiation; positive regulation of fat cell differentiation; epithelial to mesenchymal transition; positive regulation of histone acetylation; negative regulation of cell adhesion mediated by integrin; regulation of chemokine production; positive regulation of cell migration

Disease: Waardenburg Syndrome, Type 2d; Piebald Trait

Research Articles on SNAI2

Similar Products

Product Notes

The SNAI2 snai2 (Catalog #AAA3201436) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SNAI2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's SNAI2 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the SNAI2 snai2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SDTSSKDHSG SESPISDEEE RLQSKLSDPH AIEAEKFQCN LCNKTYSTFS. It is sometimes possible for the material contained within the vial of "SNAI2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.