Western Blot (WB)
(WB Suggested Anti-SNAG1 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysate)
Rabbit SNAG1 Polyclonal Antibody | anti-SNX18 antibody
SNAG1 antibody - N-terminal region
Gene Names
SNX18; SNAG1; SH3PX2; SH3PXD3B
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SNAG1; Polyclonal Antibody; SNAG1 antibody - N-terminal region; anti-SNX18 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LLQPQQAPPPSTFQPPGAGFPYGGGALQPSPQQLYGGYQASQGSDDDWDD
Sequence Length
628
Applicable Applications for anti-SNX18 antibody
Western Blot (WB)
Homology
Cow: 88%; Dog: 80%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rat: 93%; Yeast: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SNAG1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-SNAG1 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysate)
Western Blot (WB)
(WB Suggested Anti-SNAG1 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysate)
Related Product Information for anti-SNX18 antibody
This is a rabbit polyclonal antibody against SNAG1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region, like
Target Description: This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region, like
Product Categories/Family for anti-SNX18 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
69kDa
NCBI Official Full Name
sorting nexin-18 isoform b
NCBI Official Synonym Full Names
sorting nexin 18
NCBI Official Symbol
SNX18
NCBI Official Synonym Symbols
SNAG1; SH3PX2; SH3PXD3B
NCBI Protein Information
sorting nexin-18
UniProt Protein Name
Sorting nexin-18
Protein Family
UniProt Gene Name
SNX18
UniProt Synonym Gene Names
SH3PXD3B; SNAG1
UniProt Entry Name
SNX18_HUMAN
NCBI Description
This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region, like some family members, but contains a SH3 domain. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Research Articles on SNX18
Similar Products
Product Notes
The SNX18 snx18 (Catalog #AAA3210793) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SNAG1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's SNAG1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SNX18 snx18 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LLQPQQAPPP STFQPPGAGF PYGGGALQPS PQQLYGGYQA SQGSDDDWDD. It is sometimes possible for the material contained within the vial of "SNAG1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
