Mouse anti-Human TBX5 Monoclonal Antibody | anti-TBX5 antibody

TBX5 (T-box Transcription Factor TBX5, T-box Protein 5) (PE)

Cat. Num. AAA6160650

• Gene Names: TBX5; HOS
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: TBX5; Monoclonal Antibody; TBX5 (T-box Transcription Factor TBX5; T-box Protein 5) (PE); anti-TBX5 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1G10
• Specificity: Recognizes human TBX5.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 3748

• Applicable Applications for anti-TBX5 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa402-519 from human TBX5 (AAH27942) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PSMPSYSSCTVTTVQPMDRLPYQHFSAHFTSGPLVPRLAGMANHGSPQLGEGMFQHQTSVAHQPVVRQCGPQTGLQSPGTLQPPEFLYSHGVPRTLSPHQYHSVHGVGMVPEWSDNS
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of TBX5 expression in transfected 293T cell line by TBX5 monoclonal antibody. Lane 1: TBX5 transfected lysate (57.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB)

(Western blot analysis of TBX5 over-expressed 293 cell line, cotransfected with TBX5 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with TBX5 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Related Product Information for anti-TBX5 antibody

T-box transcription factors contain a novel type of DNA-binding domain, the T-box domain, which are encoded by an ancient gene family. Four T-box genes, omb, Trg, org-1, and H15, have been identified in Drosophila, whereas in mammals the T-box gene family has expanded, and 12 human T-box genes have been isolated. Most T-box genes have discrete spatial and temporal patterns of expression during embryogenesis. T-box 5 (TBX5) is the human homolog of mouse Tbx5, which is closely linked to Tbx3 on mouse chromosome 5. Similarly, both this gene and TBX3 map to human chromosome 12. Expression studies in mouse and chicken show that Tbx5 is expressed in developing forelimb, but not in hindlimb buds, suggesting a role for this gene in regulating limb development and specification of limb identity. Mutations in this gene have been associated with Holt-Oram syndrome, a developmental disorder affecting the heart and upper limbs. Several transcript variants encoding different isoforms have been described for this gene.

Product Categories/Family for anti-TBX5 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 20379838
• NCBI GeneID: 6910
• NCBI Official Full Name: Homo sapiens T-box 5, mRNA
• NCBI Official Synonym Full Names: T-box transcription factor 5
• NCBI Official Symbol: TBX5
• NCBI Official Synonym Symbols: HOS
• NCBI Protein Information: T-box transcription factor TBX5
• Protein Family: T-box transcription factor

NCBI Description

This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene is closely linked to related family member T-box 3 (ulnar mammary syndrome) on human chromosome 12. The encoded protein may play a role in heart development and specification of limb identity. Mutations in this gene have been associated with Holt-Oram syndrome, a developmental disorder affecting the heart and upper limbs. Several transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008]