Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SMC4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysateThere is BioGPS gene expression data showing that SMC4 is expressed in MCF7)

Rabbit SMC4 Polyclonal Antibody | anti-SMC4 antibody

SMC4 antibody - middle region

Gene Names
SMC4; CAPC; CAP-C; SMC-4; SMC4L1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SMC4; Polyclonal Antibody; SMC4 antibody - middle region; anti-SMC4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EARCHEMKPNLGAIAEYKKKEELYLQRVAELDKITYERDSFRQAYEDLRK
Sequence Length
1288
Applicable Applications for anti-SMC4 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SMC4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SMC4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysateThere is BioGPS gene expression data showing that SMC4 is expressed in MCF7)

Western Blot (WB) (WB Suggested Anti-SMC4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysateThere is BioGPS gene expression data showing that SMC4 is expressed in MCF7)
Related Product Information for anti-SMC4 antibody
This is a rabbit polyclonal antibody against SMC4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SMC4 is the central component of the condensin complex, a complex required for conversion of interphase chromatin into mitotic-like condense chromosomes. The condensin complex probably introduces positive supercoils into relaxed DNA in the presence of type I topoisomerases and converts nicked DNA into positive knotted forms in the presence of type II topoisomerases.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
147kDa
NCBI Official Full Name
structural maintenance of chromosomes protein 4 isoform 1
NCBI Official Synonym Full Names
structural maintenance of chromosomes 4
NCBI Official Symbol
SMC4
NCBI Official Synonym Symbols
CAPC; CAP-C; SMC-4; SMC4L1
NCBI Protein Information
structural maintenance of chromosomes protein 4
UniProt Protein Name
Structural maintenance of chromosomes protein 4
UniProt Gene Name
SMC4
UniProt Synonym Gene Names
CAPC; SMC4L1; SMC protein 4; SMC-4; hCAP-C
UniProt Entry Name
SMC4_HUMAN

NCBI Description

This gene belongs to the 'structural maintenance of chromosomes' (SMC) gene family. Members of this gene family play a role in two changes in chromosome structure during mitotic segregation of chromosomes- chromosome condensation and sister chromatid cohesion. The protein encoded by this gene is likely a subunit of the 13S condensin complex, which is involved in chromosome condensation. A pseudogene related to this gene is located on chromosome 2. [provided by RefSeq, Jun 2016]

Uniprot Description

SMC4: Central component of the condensin complex, a complex required for conversion of interphase chromatin into mitotic-like condense chromosomes. The condensin complex probably introduces positive supercoils into relaxed DNA in the presence of type I topoisomerases and converts nicked DNA into positive knotted forms in the presence of type II topoisomerases. Forms an heterodimer with SMC2. Component of the condensin complex, which contains the SMC2 and SMC4 heterodimer, and three non SMC subunits that probably regulate the complex: BRRN1/CAPH, CNAP1/CAPD2 and CAPG. Widely expressed. Higher expression in testis, colon, thymus. Belongs to the SMC family. SMC4 subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell cycle regulation

Chromosomal Location of Human Ortholog: 3q26.1

Cellular Component: nucleoplasm; cytoplasm; condensin complex; cytosol; nucleus

Molecular Function: protein binding; protein heterodimerization activity; ATP binding

Biological Process: mitotic sister chromatid segregation; meiotic chromosome condensation; mitotic chromosome condensation; cell division; mitotic cell cycle; kinetochore organization and biogenesis; meiotic chromosome segregation

Research Articles on SMC4

Similar Products

Product Notes

The SMC4 smc4 (Catalog #AAA3208074) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SMC4 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SMC4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SMC4 smc4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EARCHEMKPN LGAIAEYKKK EELYLQRVAE LDKITYERDS FRQAYEDLRK. It is sometimes possible for the material contained within the vial of "SMC4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.