Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of SMAD1 expression in transfected 293T cell line by SMAD1 polyclonal antibody. Lane 1: SMAD1 transfected lysate (52.3kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human SMAD1 Polyclonal Antibody | anti-SMAD1 antibody

SMAD1 (Mothers Against Decapentaplegic Homolog 1, Mothers Against DPP Homolog 1, MAD Homolog 1, MADH1, SMAD Family Member 1, SMAD 1, hSMAD1, BSP-1, BSP1, JV4-1, JV41, Mad-related Protein 1, MADR1, Transforming Growth Factor-beta-signaling Protein 1) (FITC

Gene Names
SMAD1; BSP1; JV41; BSP-1; JV4-1; MADH1; MADR1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SMAD1; Polyclonal Antibody; SMAD1 (Mothers Against Decapentaplegic Homolog 1; Mothers Against DPP Homolog 1; MAD Homolog 1; MADH1; SMAD Family Member 1; SMAD 1; hSMAD1; BSP-1; BSP1; JV4-1; JV41; Mad-related Protein 1; MADR1; Transforming Growth Factor-beta-signaling Protein 1) (FITC; anti-SMAD1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SMAD1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Applicable Applications for anti-SMAD1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human SMAD1, aa1-465 (NP_001003688.1).
Immunogen Sequence
MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPNSHPFPHSPNSSYPNSPGSSSSTYPHSPTSSDPGSPFQMPADTPPPAYLPPEDPMTQDGSQPMDTNMMAPPLPSEINRGDVQAVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFTDPSNNKNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNCNYHHGFHPTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFETVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of SMAD1 expression in transfected 293T cell line by SMAD1 polyclonal antibody. Lane 1: SMAD1 transfected lysate (52.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SMAD1 expression in transfected 293T cell line by SMAD1 polyclonal antibody. Lane 1: SMAD1 transfected lysate (52.3kD). Lane 2: Non-transfected lysate.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between SMAD1 and GLI3. HeLa cells were stained with SMAD1 rabbit purified polyclonal 1:1200 and GLI3 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between SMAD1 and GLI3. HeLa cells were stained with SMAD1 rabbit purified polyclonal 1:1200 and GLI3 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Product Categories/Family for anti-SMAD1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52,260 Da
NCBI Official Full Name
mothers against decapentaplegic homolog 1
NCBI Official Synonym Full Names
SMAD family member 1
NCBI Official Symbol
SMAD1
NCBI Official Synonym Symbols
BSP1; JV41; BSP-1; JV4-1; MADH1; MADR1
NCBI Protein Information
mothers against decapentaplegic homolog 1; MAD homolog 1; Mad-related protein 1; TGF-beta signaling protein 1; mothers against DPP homolog 1; SMAD, mothers against DPP homolog 1; MAD, mothers against decapentaplegic homolog 1; transforming growth factor-b
UniProt Protein Name
Mothers against decapentaplegic homolog 1
UniProt Gene Name
SMAD1
UniProt Synonym Gene Names
BSP1; MADH1; MADR1; MAD homolog 1; Mothers against DPP homolog 1; SMAD 1; Smad1; hSMAD1; BSP-1
UniProt Entry Name
SMAD1_HUMAN

NCBI Description

The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein mediates the signals of the bone morphogenetic proteins (BMPs), which are involved in a range of biological activities including cell growth, apoptosis, morphogenesis, development and immune responses. In response to BMP ligands, this protein can be phosphorylated and activated by the BMP receptor kinase. The phosphorylated form of this protein forms a complex with SMAD4, which is important for its function in the transcription regulation. This protein is a target for SMAD-specific E3 ubiquitin ligases, such as SMURF1 and SMURF2, and undergoes ubiquitination and proteasome-mediated degradation. Alternatively spliced transcript variants encoding the same protein have been observed. [provided by RefSeq, Jul 2008]

Uniprot Description

SMAD1: transcription factor phosphorylated and activated by bone morphogenetic protein type 1 receptor kinases. Participates in a wide range of critical processes including morphogenesis, cell-fate determination, proliferation, differentiation and apoptosis. Phosphorylated forms dimerize with collaborating Smad4 and are translocated into the nucleus, where the transcription of target genes is stimulated.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 4q31

Cellular Component: nucleoplasm; transcription factor complex; protein complex; cytoplasm; integral to membrane; nuclear inner membrane; intracellular; cytosol; nucleus

Molecular Function: identical protein binding; protein binding; metal ion binding; receptor signaling protein activity; protein kinase binding; transcription factor activity; transforming growth factor beta receptor, pathway-specific cytoplasmic mediator activity

Biological Process: wound healing; cardiac muscle cell proliferation; primary microRNA processing; signal transduction; embryonic pattern specification; protein amino acid phosphorylation; mesodermal cell fate commitment; BMP signaling pathway; negative regulation of cell proliferation; homeostatic process; ureteric bud development; transforming growth factor beta receptor signaling pathway; midbrain development; inflammatory response; hindbrain development; response to drug; transcription, DNA-dependent; MAPKKK cascade; positive regulation of dendrite morphogenesis; response to organic nitrogen; SMAD protein complex assembly; positive regulation of osteoblast differentiation; cartilage development; gamete generation; positive regulation of transcription from RNA polymerase II promoter; osteoblast fate commitment

Research Articles on SMAD1

Similar Products

Product Notes

The SMAD1 smad1 (Catalog #AAA6394424) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SMAD1 (Mothers Against Decapentaplegic Homolog 1, Mothers Against DPP Homolog 1, MAD Homolog 1, MADH1, SMAD Family Member 1, SMAD 1, hSMAD1, BSP-1, BSP1, JV4-1, JV41, Mad-related Protein 1, MADR1, Transforming Growth Factor-beta-signaling Protein 1) (FITC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SMAD1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SMAD1 smad1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SMAD1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.