Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of DIABLO expression in transfected 293T cell line by DIABLO polyclonal antibody. Lane 1: DIABLO transfected lysate (27.1kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human SMAC Polyclonal Antibody | anti-SMAC antibody

SMAC (Diablo Homolog, Mitochondrial, Second Mitochondria-derived Activator Of Caspase, Smac, Direct IAP-binding Protein With Low pI, DIABLO, FLJ10537, FLJ25049) (Biotin)

Gene Names
DIABLO; SMAC; SMAC3; DFNA64; DIABLO-S
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SMAC; Polyclonal Antibody; SMAC (Diablo Homolog; Mitochondrial; Second Mitochondria-derived Activator Of Caspase; Smac; Direct IAP-binding Protein With Low pI; DIABLO; FLJ10537; FLJ25049) (Biotin); anti-SMAC antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human DIABLO.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-SMAC antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human DIABLO, aa1-239 (NP_063940.1).
Immunogen Sequence
MAALKSWLSRSVTSFFRYRQCLCVPVVANFKKRCFSELIRPWHKTVTIGFGVTLCAVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of DIABLO expression in transfected 293T cell line by DIABLO polyclonal antibody. Lane 1: DIABLO transfected lysate (27.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of DIABLO expression in transfected 293T cell line by DIABLO polyclonal antibody. Lane 1: DIABLO transfected lysate (27.1kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-SMAC antibody
Second mitochondria-derived activator of caspase (SMAC) has been implicated in the activation of apoptosis in response to cell stress. SMAC promotes CASP9 activation by binding to IAPs and removing their inhibitory activity. The inhibitor of apoptosis proteins (IAPs) regulate programmed cell death by inhibiting members of the caspase family of enzymes. Smac/DIABLO is a mitochondrial protein that is released along with cytochrome c during apoptosis and activates cytochrome c/Apaf-1/caspase-9 pathway. Smac is an antagonist of the X-linked inhibitor of apoptosis (XIAP)-the most potent caspase inhibitor of all known inhibitor of apoptosis-family members. Smac promotes apoptosis by eliminating the inhibitory effect of inhibitor-of-apoptosis (IAPs) through physical interactions.
Product Categories/Family for anti-SMAC antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27,131 Da
NCBI Official Full Name
diablo homolog, mitochondrial isoform 1
NCBI Official Synonym Full Names
diablo, IAP-binding mitochondrial protein
NCBI Official Symbol
DIABLO
NCBI Official Synonym Symbols
SMAC; SMAC3; DFNA64; DIABLO-S
NCBI Protein Information
diablo homolog, mitochondrial; 0610041G12Rik; mitochondrial Smac protein; direct IAP-binding protein with low pI; second mitochondria-derived activator of caspase
UniProt Protein Name
Diablo homolog, mitochondrial
UniProt Gene Name
DIABLO
UniProt Synonym Gene Names
SMAC; Smac
UniProt Entry Name
DBLOH_HUMAN

Uniprot Description

DIABLO: Promotes apoptosis by activating caspases in the cytochrome c/Apaf-1/caspase-9 pathway. Acts by opposing the inhibitory activity of inhibitor of apoptosis proteins (IAP). Inhibits the activity of BIRC6/bruce by inhibiting its binding to caspases. Isoform 3 attenuates the stability and apoptosis- inhibiting activity of XIAP/BIRC4 by promoting XIAP/BIRC4 ubiquitination and degradation through the ubiquitin-proteasome pathway. Isoform 3 also disrupts XIAP/BIRC4 interacting with processed caspase-9 and promotes caspase-3 activation. Isoform 1 is defective in the capacity to down-regulate the XIAP/BIRC4 abundance. Homodimer. Interacts with NGFRAP1/BEX3. Interacts with BIRC2/c-IAP1, BIRC3/c-IAP2, XIAP/BIRC4, BIRC6/bruce and BIRC7/livin. Interacts with the monomeric and dimeric form of BIRC5/survivin. Ubiquitously expressed with highest expression in testis. Expression is also high in heart, liver, kidney, spleen, prostate and ovary. Low in brain, lung, thymus and peripheral blood leukocytes. Isoform 3 is ubiquitously expressed. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Apoptosis; Mitochondrial

Chromosomal Location of Human Ortholog: 12q24.31

Cellular Component: internal side of plasma membrane; mitochondrion; mitochondrial intermembrane space; cytosol

Molecular Function: protein binding

Biological Process: caspase activation; neuron apoptosis; induction of apoptosis via death domain receptors; positive regulation of apoptosis; apoptosis; caspase activation via cytochrome c; induction of apoptosis by oxidative stress

Disease: Deafness, Autosomal Dominant 64

Similar Products

Product Notes

The SMAC diablo (Catalog #AAA6394412) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SMAC (Diablo Homolog, Mitochondrial, Second Mitochondria-derived Activator Of Caspase, Smac, Direct IAP-binding Protein With Low pI, DIABLO, FLJ10537, FLJ25049) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SMAC can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SMAC diablo for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SMAC, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.