Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of 293T cells, using SLC9A8 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)

Rabbit anti-Human SLC9A8 Polyclonal Antibody | anti-SLC9A8 antibody

SLC9A8 Polyclonal Antibody

Gene Names
SLC9A8; NHE8; NHE-8
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
SLC9A8; Polyclonal Antibody; SLC9A8 Polyclonal Antibody; NHE-8; NHE8; anti-SLC9A8 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
RLMDIEDAKAHRRNKKDVNLSKTEKMGNTVESEHLSELTEEEYEAHYIRRQDLKGFVWLDAKYLNPFFTRRLTQEDLHHGRIQMKTLTNKWYEEVRQGPSGSEDDEQELL
Sequence Length
597
Applicable Applications for anti-SLC9A8 antibody
Western Blot (WB)
Application Notes
WB: 1:1000 - 1:2000
Immunogen
Recombinant protein of human SLC9A8
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Golgi apparatus membrane, Multi-pass membrane protein
Positive Samples
293T
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of 293T cells, using SLC9A8 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)

Western Blot (WB) (Western blot analysis of extracts of 293T cells, using SLC9A8 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Product Categories/Family for anti-SLC9A8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 65kDa; 67kDa
Observed: 65kDa
NCBI Official Full Name
sodium/hydrogen exchanger 8 isoform 1
NCBI Official Synonym Full Names
solute carrier family 9 member A8
NCBI Official Symbol
SLC9A8
NCBI Official Synonym Symbols
NHE8; NHE-8
NCBI Protein Information
sodium/hydrogen exchanger 8
UniProt Protein Name
Sodium/hydrogen exchanger 8
UniProt Gene Name
SLC9A8
UniProt Synonym Gene Names
KIAA0939; NHE8; NHE-8

NCBI Description

Sodium-hydrogen exchangers (NHEs), such as SLC9A8, are integral transmembrane proteins that exchange extracellular Na+ for intracellular H+. NHEs have multiple functions, including intracellular pH homeostasis, cell volume regulation, and electroneutral NaCl absorption in epithelia (Xu et al., 2008 [PubMed 18209477]).[supplied by OMIM, Apr 2009]

Uniprot Description

Involved in pH regulation to eliminate acids generated by active metabolism or to counter adverse environmental conditions. Major proton extruding system driven by the inward sodium ion chemical gradient. Plays an important role in signal transduction.

Research Articles on SLC9A8

Similar Products

Product Notes

The SLC9A8 slc9a8 (Catalog #AAA9132983) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC9A8 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC9A8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:1000 - 1:2000. Researchers should empirically determine the suitability of the SLC9A8 slc9a8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RLMDIEDAKA HRRNKKDVNL SKTEKMGNTV ESEHLSELTE EEYEAHYIRR QDLKGFVWLD AKYLNPFFTR RLTQEDLHHG RIQMKTLTNK WYEEVRQGPS GSEDDEQELL. It is sometimes possible for the material contained within the vial of "SLC9A8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.