Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (SLC7A8 antibody (MBS5303178) used at 1.25 ug/ml to detect target protein.)

Rabbit SLC7A8 Polyclonal Antibody | anti-SLC7A8 antibody

SLC7A8 antibody

Gene Names
SLC7A8; LAT2; LPI-PC1
Reactivity
Human, Mouse, Rat, Dog, Zebrafish
Applications
Western Blot
Purity
Total IgG Protein A purified
Synonyms
SLC7A8; Polyclonal Antibody; SLC7A8 antibody; Polyclonal SLC7A8; Anti-SLC7A8; SLCA8-7; SLCA8 7; Solute Carrier Family 7 Member 8; Cationic Amino Acid Transporter Y+ System 8; LPI-PC1; LAT2; anti-SLC7A8 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat, Dog, Zebrafish
Clonality
Polyclonal
Purity/Purification
Total IgG Protein A purified
Form/Format
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SLC7A8 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
535
Applicable Applications for anti-SLC7A8 antibody
Western Blot (WB)
Application Notes
WB: 1.25 ug/ml
Biological Significance
SLC7A8 is sodium-independent, high-affinity transport of large neutral amino acids. It has higher affinity for L-phenylalanine than LAT1 but lower affinity for glutamine and serine. L-alanine is transported at physiological concentrations. SLC7A8 also plays a role in basolateral (re)absorption of neutral amino acids.
Cross-Reactivity
Human, Mouse, Rat, Dog, ZebraFish
Immunogen
SLC7A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRAIFISIPLVTFVYVFANVAYVTAMSPQELLASNAVAVTFGEKLLGVMA
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(SLC7A8 antibody (MBS5303178) used at 1.25 ug/ml to detect target protein.)

Western Blot (WB) (SLC7A8 antibody (MBS5303178) used at 1.25 ug/ml to detect target protein.)
Related Product Information for anti-SLC7A8 antibody
Rabbit polyclonal SLC7A8 antibody
Product Categories/Family for anti-SLC7A8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
37 kDa (MW of target protein)
NCBI Official Full Name
SLC7A8 protein
NCBI Official Synonym Full Names
solute carrier family 7 (amino acid transporter light chain, L system), member 8
NCBI Official Symbol
SLC7A8
NCBI Official Synonym Symbols
LAT2; LPI-PC1
NCBI Protein Information
large neutral amino acids transporter small subunit 2
UniProt Protein Name
Large neutral amino acids transporter small subunit 2
UniProt Gene Name
SLC7A8
UniProt Synonym Gene Names
LAT2; hLAT2
UniProt Entry Name
LAT2_HUMAN

Uniprot Description

SLC7A8: Sodium-independent, high-affinity transport of small and large neutral amino acids such as alanine, serine, threonine, cysteine, phenylalanine, tyrosine, leucine, arginine and tryptophan, when associated with SLC3A2/4F2hc. Acts as an amino acid exchanger. Has higher affinity for L-phenylalanine than LAT1 but lower affinity for glutamine and serine. L-alanine is transported at physiological concentrations. Plays a role in basolateral (re)absorption of neutral amino acids. Involved in the uptake of methylmercury (MeHg) when administered as the L-cysteine or D,L-homocysteine complexes, and hence plays a role in metal ion homeostasis and toxicity. Involved in the cellular activity of small molecular weight nitrosothiols, via the stereoselective transport of L-nitrosocysteine (L-CNSO) across the transmembrane. Plays an essential role in the reabsorption of neutral amino acids from the epithelial cells to the bloodstream in the kidney. Belongs to the amino acid-polyamine-organocation (APC) superfamily. L-type amino acid transporter (LAT) (TC 2.A.3.8) family.

Protein type: Transporter, SLC family; Transporter; Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 14q11.2

Cellular Component: basolateral plasma membrane; integral to plasma membrane; cytoplasm; plasma membrane

Molecular Function: L-amino acid transmembrane transporter activity; protein binding; peptide antigen binding; neutral amino acid transmembrane transporter activity; toxin transporter activity; organic cation transmembrane transporter activity; amino acid transmembrane transporter activity

Biological Process: amino acid metabolic process; neutral amino acid transport; metal ion homeostasis; organic cation transport; transport; amino acid transport; response to toxin; ion transport; blood coagulation; leukocyte migration; transmembrane transport

Research Articles on SLC7A8

Similar Products

Product Notes

The SLC7A8 slc7a8 (Catalog #AAA5303178) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC7A8 antibody reacts with Human, Mouse, Rat, Dog, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SLC7A8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1.25 ug/ml. Researchers should empirically determine the suitability of the SLC7A8 slc7a8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC7A8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.