Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (SLC7A7 antibody (MBS839151) used at 1 ug/ml to detect target protein.)

Rabbit SLC7A7 Polyclonal Antibody | anti-SLC7A7 antibody

SLC7A7 antibody

Gene Names
SLC7A7; LPI; LAT3; MOP-2; Y+LAT1; y+LAT-1
Applications
Western Blot
Purity
Affinity purified
Synonyms
SLC7A7; Polyclonal Antibody; SLC7A7 antibody; Polyclonal SLC7A7; Anti-SLC7A7; SLCA-7; Solute Carrier Family 7 Member 7; Cationic Amino Acid Transporter Y+ System 7; LAT3; SLCA 7; Y+LAT1; LPI; y+LAT-1; anti-SLC7A7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC7A7 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
511
Applicable Applications for anti-SLC7A7 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
The protein encoded by this gene is the light subunit of a cationic amino acid transporter. This sodium-independent transporter is formed when the light subunit encoded by this gene dimerizes with the heavy subunit transporter protein SLC3A2. This transporter is found in epithelial cell membranes where it transfers cationic and large neutral amino acids from the cell to the extracellular space. Defects in this gene are a cause of lysinuric protein intolerance (LPI). Several transcript variants encoding the same protein have been found for this gene.
Cross-Reactivity
Human
Immunogen
SLC7A7 antibody was raised using a synthetic peptide corresponding to a region with amino acids WGTLVQDIFTYAKVLALIAVIVAGIVRLGQGASTHFENSFEGSSFAVGDI
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(SLC7A7 antibody (MBS839151) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (SLC7A7 antibody (MBS839151) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-SLC7A7 antibody
Rabbit polyclonal SLC7A7 antibody
Product Categories/Family for anti-SLC7A7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
56 kDa (MW of target protein)
NCBI Official Full Name
SLC7A7
NCBI Official Synonym Full Names
solute carrier family 7 (amino acid transporter light chain, y+L system), member 7
NCBI Official Symbol
SLC7A7
NCBI Official Synonym Symbols
LPI; LAT3; MOP-2; Y+LAT1; y+LAT-1
NCBI Protein Information
Y+L amino acid transporter 1
UniProt Protein Name
Y+L amino acid transporter 1
UniProt Gene Name
SLC7A7
UniProt Synonym Gene Names
MOP-2; Y+LAT1; y+LAT-1
UniProt Entry Name
YLAT1_HUMAN

NCBI Description

The protein encoded by this gene is the light subunit of a cationic amino acid transporter. This sodium-independent transporter is formed when the light subunit encoded by this gene dimerizes with the heavy subunit transporter protein SLC3A2. This transporter is found in epithelial cell membranes where it transfers cationic and large neutral amino acids from the cell to the extracellular space. Defects in this gene are a cause of lysinuric protein intolerance (LPI). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2011]

Uniprot Description

SLC7A7: Involved in the sodium-independent uptake of dibasic amino acids and sodium-dependent uptake of some neutral amino acids. Requires coexpression with SLC3A2/4F2hc to mediate the uptake of arginine, leucine and glutamine. Plays a role in nitric oxide synthesis in human umbilical vein endothelial cells (HUVECs) via transport of L-arginine. Involved in the transport of L- arginine in monocytes. Defects in SLC7A7 are the cause of lysinuric protein intolerance (LPI). LPI is an autosomal recessive multisystem disorder found mainly in Finland and Italy. On a normal diet, LPI patients present poor feeding, vomiting, diarrhea, episodes of hyperammoniaemic coma and growth retardation. Hepatosplenomegaly, osteoporosis and a life- threatening pulmonary involvement (alveolar proteinosis) are also seen. Biochemically LPI is characterized by a defect in the plasma membrane transport of dibasic amino acids. Belongs to the amino acid-polyamine-organocation (APC) superfamily. L-type amino acid transporter (LAT) (TC 2.A.3.8) family.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; Transporter, SLC family; Transporter

Chromosomal Location of Human Ortholog: 14q11.2

Cellular Component: basolateral plasma membrane; integral to plasma membrane; plasma membrane

Molecular Function: amino acid transmembrane transporter activity

Biological Process: amino acid metabolic process; amino acid transport; transport; ion transport; protein complex assembly; blood coagulation; transmembrane transport; leukocyte migration

Disease: Lysinuric Protein Intolerance

Research Articles on SLC7A7

Similar Products

Product Notes

The SLC7A7 slc7a7 (Catalog #AAA839151) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SLC7A7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the SLC7A7 slc7a7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC7A7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.