Rabbit anti-Human, Mouse SLC6A8 Polyclonal Antibody | anti-SLC6A8 antibody

SLC6A8 Rabbit pAb

Cat. Num. AAA9142826

• Gene Names: SLC6A8; CRT; CT1; CRTR
• Reactivity: Human, Mouse
• Applications: Western Blot
• Purity: Affinity purification
• Synonyms: SLC6A8; Polyclonal Antibody; SLC6A8 Rabbit pAb; CCDS1; CRT; CRTR; CT1; CTR5; anti-SLC6A8 antibody

• Host: Rabbit
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Affinity purification
• Form/Format: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
• Sequence: VVYYEPLVYNNTYVYPWWGEAMGWAFALSSMLCVPLHLLGCLLRAKGTMAERWQHLTQPIWGLHHLEYRAQDADVRGLTTLTPVSESSKVVVVESVM

• Applicable Applications for anti-SLC6A8 antibody: Western Blot (WB)
• Application Notes: WB: 1:500-1:2000
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 539-635 of human SLC6A8 (NP_005620.1).
• Positive Samples: 293T, U-87MG, Mouse brain
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using SLC6A8 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

Related Product Information for anti-SLC6A8 antibody

Background: The protein encoded by this gene is a plasma membrane protein whose function is to transport creatine into and out of cells. Defects in this gene can result in X-linked creatine deficiency syndrome. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2008]

NCBI and Uniprot Product Information

• NCBI GI #: 218563756
• NCBI GeneID: 6535
• NCBI Accession #: NP_001136277.1
• NCBI GenBank Nucleotide #: NM_001142805.1
• UniProt Accession #: P48029; Q13032; Q66I36; B2KY47; B4DIA3; E9PFC0
• Molecular Weight: 70,523 Da
• NCBI Official Full Name: sodium- and chloride-dependent creatine transporter 1 isoform 2
• NCBI Official Synonym Full Names: solute carrier family 6 (neurotransmitter transporter, creatine), member 8
• NCBI Official Symbol: SLC6A8
• NCBI Official Synonym Symbols: CRT; CT1; CRTR
• NCBI Protein Information: sodium- and chloride-dependent creatine transporter 1; creatine transporter SLC6A8; solute carrier family 6 member 8
• UniProt Protein Name: Sodium- and chloride-dependent creatine transporter 1
• Protein Family: Sodium- and chloride-dependent creatine transporter
• UniProt Gene Name: SLC6A8
• UniProt Synonym Gene Names: CT1
• UniProt Entry Name: SC6A8_HUMAN

NCBI Description

The protein encoded by this gene is a plasma membrane protein whose function is to transport creatine into and out of cells. Defects in this gene can result in X-linked creatine deficiency syndrome. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2008]

Uniprot Description

SLC6A8: Required for the uptake of creatine in muscles and brain. Defects in SLC6A8 are the cause of X-linked creatine deficiency syndrome (XL-CDS). XL-CDS causes developmental delay, hypotonia, mental retardation, seizures, short stature and midface hypoplasia. Belongs to the sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family. SLC6A8 subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Membrane protein, integral; Motility/polarity/chemotaxis; Transporter, SLC family; Transporter

Chromosomal Location of Human Ortholog: Xq28

Cellular Component: integral to plasma membrane; plasma membrane; integral to membrane

Molecular Function: creatine transporter activity; neurotransmitter:sodium symporter activity; creatine:sodium symporter activity

Biological Process: muscle contraction; neurotransmitter transport; transport; sodium ion transport; creatine metabolic process; creatine transport

Disease: Cerebral Creatine Deficiency Syndrome 1