Western Blot (WB)
(WB Suggested Anti-Slc6a15 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Kidney )
Rabbit Slc6a15 Polyclonal Antibody | anti-SLC6A15 antibody
Slc6a15 antibody - middle region
Gene Names
Slc6a15; v7-3; AA536730; AI326450; AI326451
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Slc6a15; Polyclonal Antibody; Slc6a15 antibody - middle region; anti-SLC6A15 antibody
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VEDYRLVYDIIQKVKEEEFAVLHLNACQIEDELNKAVQGTGLAFIAFTEA
Sequence Length
729
Applicable Applications for anti-SLC6A15 antibody
Western Blot (WB)
Homology
Cow: 86%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 86%; Rabbit: 79%; Rat: 86%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-Slc6a15 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Kidney )
Western Blot (WB)
(WB Suggested Anti-Slc6a15 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Kidney )
Related Product Information for anti-SLC6A15 antibody
This is a rabbit polyclonal antibody against Slc6a15. It was validated on Western Blot
Target Description: Slc6a15 functions as a sodium-dependent neutral amino acid transporter. It exhibits preference for methionine and for the branched-chain amino acids, particulary leucine, valine and isoleucine. It mediates the saturable, pH-sensitive and electrogenic cotransport of proline and sodium ions with a stoichiometry of 1:1. Slc6a15 may have a role as transporter for neurotransmitter precursors into neurons. In contrast to other members of the neurotransmitter transporter family, Slc6a15 does not appear to be chloride-dependent.
Target Description: Slc6a15 functions as a sodium-dependent neutral amino acid transporter. It exhibits preference for methionine and for the branched-chain amino acids, particulary leucine, valine and isoleucine. It mediates the saturable, pH-sensitive and electrogenic cotransport of proline and sodium ions with a stoichiometry of 1:1. Slc6a15 may have a role as transporter for neurotransmitter precursors into neurons. In contrast to other members of the neurotransmitter transporter family, Slc6a15 does not appear to be chloride-dependent.
Product Categories/Family for anti-SLC6A15 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
82kDa
NCBI Official Full Name
sodium-dependent neutral amino acid transporter B(0)AT2
NCBI Official Synonym Full Names
solute carrier family 6 (neurotransmitter transporter), member 15
NCBI Official Symbol
Slc6a15
NCBI Official Synonym Symbols
v7-3; AA536730; AI326450; AI326451
NCBI Protein Information
sodium-dependent neutral amino acid transporter B(0)AT2
UniProt Protein Name
Sodium-dependent neutral amino acid transporter B(0)AT2
UniProt Gene Name
Slc6a15
UniProt Synonym Gene Names
B0at2; Ntt73
UniProt Entry Name
S6A15_MOUSE
Research Articles on SLC6A15
Similar Products
Product Notes
The SLC6A15 slc6a15 (Catalog #AAA3207239) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Slc6a15 antibody - middle region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Slc6a15 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SLC6A15 slc6a15 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VEDYRLVYDI IQKVKEEEFA VLHLNACQIE DELNKAVQGT GLAFIAFTEA. It is sometimes possible for the material contained within the vial of "Slc6a15, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
