Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (SLC5A7 antibody (MBS5302924) used at 1 ug/ml to detect target protein.)

Rabbit SLC5A7 Polyclonal Antibody | anti-SLC5A7 antibody

SLC5A7 antibody

Gene Names
SLC5A7; CHT; CHT1; hCHT; HMN7A
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
SLC5A7; Polyclonal Antibody; SLC5A7 antibody; Polyclonal SLC5A7; Anti-SLC5A7; hCHT; SLCA7 5; Choline Tansporter 7; Solute Carrier Family 5 Member 7; CHT; CHT1; SLCA7-5; MGC126299; MGC126300; anti-SLC5A7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC5A7 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
333
Applicable Applications for anti-SLC5A7 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
Choline is a direct precursor of acetylcholine (ACh), a neurotransmitter of the central and peripheral nervous system that regulates a variety of autonomic, cognitive, and motor functions. SLC5A7 is a Na(+)- and Cl(-)- dependent high-affinity transporter that mediates the uptake of choline for acetylcholine synthesis in cholinergic neurons.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
SLC5A7 antibody was raised using a synthetic peptide corresponding to a region with amino acids DDNGIYNQKFPFKTLAMVTSFLTNICISYLAKYLFESGTLPPKLDVFDAV
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(SLC5A7 antibody (MBS5302924) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (SLC5A7 antibody (MBS5302924) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-SLC5A7 antibody
Rabbit polyclonal SLC5A7 antibody
Product Categories/Family for anti-SLC5A7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
63 kDa (MW of target protein)
NCBI Official Full Name
SLC5A7 protein
NCBI Official Synonym Full Names
solute carrier family 5 (sodium/choline cotransporter), member 7
NCBI Official Symbol
SLC5A7
NCBI Official Synonym Symbols
CHT; CHT1; hCHT; HMN7A
NCBI Protein Information
high affinity choline transporter 1
UniProt Protein Name
High affinity choline transporter 1
UniProt Gene Name
SLC5A7
UniProt Synonym Gene Names
CHT1; CHT
UniProt Entry Name
SC5A7_HUMAN

NCBI Description

Choline is a direct precursor of acetylcholine (ACh), a neurotransmitter of the central and peripheral nervous system that regulates a variety of autonomic, cognitive, and motor functions. SLC5A7 is a Na(+)- and Cl(-)- dependent high-affinity transporter that mediates the uptake of choline for acetylcholine synthesis in cholinergic neurons (Apparsundaram et al., 2000 [PubMed 11027560]).[supplied by OMIM, Mar 2008]

Uniprot Description

SLC5A7: Imports choline from the extracellular space to the neuron with high affinity. Choline uptake is the rate-limiting step in acetylcholine synthesis. Sodium ion- and chloride ion- dependent. Belongs to the sodium:solute symporter (SSF) (TC 2.A.21) family.

Protein type: Transporter, SLC family; Membrane protein, multi-pass; Transporter; Membrane protein, integral

Chromosomal Location of Human Ortholog: 2q12

Cellular Component: cell soma; integral to membrane; plasma membrane

Molecular Function: choline binding; choline transmembrane transporter activity; choline:sodium symporter activity

Biological Process: synaptic transmission; acetylcholine biosynthetic process; neurotransmitter secretion; sodium ion transport; neuromuscular synaptic transmission; choline transport; transmembrane transport; synaptic transmission, cholinergic

Disease: Neuronopathy, Distal Hereditary Motor, Type Viia

Research Articles on SLC5A7

Similar Products

Product Notes

The SLC5A7 slc5a7 (Catalog #AAA5302924) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC5A7 antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SLC5A7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the SLC5A7 slc5a7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC5A7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.