Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-SLC52A3 Polyclonal Antibody)

Rabbit anti-Mouse SLC52A3 Polyclonal Antibody | anti-SLC52A3 antibody

SLC52A3 Polyclonal Antibody

Gene Names
SLC52A3; RFT2; BVVLS; RFVT3; hRFT2; BVVLS1; C20orf54; bA371L19.1
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
SLC52A3; Polyclonal Antibody; SLC52A3 Polyclonal Antibody; BVVLS; BVVLS1; C20orf54; RFT2; RFVT3; bA371L19.1; hRFT2; solute carrier family 52 member 3; anti-SLC52A3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
2.54 mg/ml (varies by lot)
Sequence Length
469
Applicable Applications for anti-SLC52A3 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 200-300 of human SLC52A3 (NP_212134.3).
Immunogen Sequence
PGMEAPLSHLESRYLPAHFSPLVFFLLLSIMMACCLVAFFVLQRQPRCWEASVEDLLNDQVTLHSIRPREENDLGPAGTVDSSQGQGYLEEKAAPCCPAHL
Positive Samples
Mouse Kidney
Cellular Location
Apical Cell Membrane, Multi-Pass Membrane Protein
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-SLC52A3 Polyclonal Antibody)

Western Blot (WB) (Western blot-SLC52A3 Polyclonal Antibody)
Related Product Information for anti-SLC52A3 antibody
This gene encodes a riboflavin transporter protein that is strongly expressed in the intestine and likely plays a role in intestinal absorption of riboflavin. The protein is predicted to have eleven transmembrane domains and a cell surface localization signal in the C-terminus. Mutations at this locus have been associated with Brown-Vialetto-Van Laere syndrome and Fazio-Londe disease.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 45kDa; 50kDa
Observed: 51kDa
NCBI Official Full Name
solute carrier family 52, riboflavin transporter, member 3
NCBI Official Synonym Full Names
solute carrier family 52 member 3
NCBI Official Symbol
SLC52A3
NCBI Official Synonym Symbols
RFT2; BVVLS; RFVT3; hRFT2; BVVLS1; C20orf54; bA371L19.1
NCBI Protein Information
solute carrier family 52, riboflavin transporter, member 3
UniProt Protein Name
Solute carrier family 52, riboflavin transporter, member 3
Protein Family
UniProt Gene Name
SLC52A3
UniProt Synonym Gene Names
C20orf54; RFT2; hRFT2
UniProt Entry Name
S52A3_HUMAN

NCBI Description

This gene encodes a riboflavin transporter protein that is strongly expressed in the intestine and likely plays a role in intestinal absorption of riboflavin. The protein is predicted to have eleven transmembrane domains and a cell surface localization signal in the C-terminus. Mutations at this locus have been associated with Brown-Vialetto-Van Laere syndrome and Fazio-Londe disease. [provided by RefSeq, Mar 2012]

Research Articles on SLC52A3

Similar Products

Product Notes

The SLC52A3 slc52a3 (Catalog #AAA9140627) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC52A3 Polyclonal Antibody reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's SLC52A3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the SLC52A3 slc52a3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC52A3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.