Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SLC39A2 Antibody Titration: 0.2-1 ug/mlPositive Control: PANC1 cell lysate)

Rabbit anti-Human SLC39A2 Polyclonal Antibody | anti-SLC39A2 antibody

SLC39A2 antibody - N-terminal region

Gene Names
SLC39A2; 6A1; ZIP2; ETI-1; ZIP-2
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SLC39A2; Polyclonal Antibody; SLC39A2 antibody - N-terminal region; anti-SLC39A2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EIESQIQKFMVQNRSASERNSSGDADSAHMEYPYGELIISLGFFFVFFLE
Sequence Length
309
Applicable Applications for anti-SLC39A2 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC39A2
Protein Size
309 amino acids
Protein Interactions
SLC39A1; KCNAB2; KCNAB1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SLC39A2 Antibody Titration: 0.2-1 ug/mlPositive Control: PANC1 cell lysate)

Western Blot (WB) (WB Suggested Anti-SLC39A2 Antibody Titration: 0.2-1 ug/mlPositive Control: PANC1 cell lysate)
Related Product Information for anti-SLC39A2 antibody
This is a rabbit polyclonal antibody against SLC39A2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene encodes a member of the ZIP family of metal ion transporters. The encoded protein functions as a zinc transporter. Mutations in this gene may be associated with susceptibility to carotid artery disease. Multiple transcript variants have been des
Product Categories/Family for anti-SLC39A2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33kDa
NCBI Official Full Name
zinc transporter ZIP2 isoform a
NCBI Official Synonym Full Names
solute carrier family 39 member 2
NCBI Official Symbol
SLC39A2
NCBI Official Synonym Symbols
6A1; ZIP2; ETI-1; ZIP-2
NCBI Protein Information
zinc transporter ZIP2
UniProt Protein Name
Zinc transporter ZIP2
Protein Family
UniProt Gene Name
SLC39A2
UniProt Synonym Gene Names
ZIP2; ZIP-2; hZIP2
UniProt Entry Name
S39A2_HUMAN

NCBI Description

This gene encodes a member of the ZIP family of metal ion transporters. The encoded protein functions as a zinc transporter. Mutations in this gene may be associated with susceptibility to carotid artery disease. Multiple transcript variants have been described. [provided by RefSeq, Mar 2010]

Uniprot Description

SLC39A2: Mediates zinc uptake. Zinc uptake may be mediated by a Zn(2+)-HCO(3)(-) symport mechanism and can function in the presence of albumin. May also transport other divalent cations. May be important in contact inhibition of normal epithelial cells and loss of its expression may play a role in tumorigenesis. Belongs to the ZIP transporter (TC 2.A.5) family.

Protein type: Transporter; Membrane protein, multi-pass; Transporter, SLC family; Membrane protein, integral

Chromosomal Location of Human Ortholog: 14q11.2

Cellular Component: integral to plasma membrane; cytoplasmic membrane-bound vesicle; plasma membrane

Molecular Function: zinc ion transmembrane transporter activity

Biological Process: zinc ion transport; transmembrane transport

Research Articles on SLC39A2

Similar Products

Product Notes

The SLC39A2 slc39a2 (Catalog #AAA3207122) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC39A2 antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC39A2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SLC39A2 slc39a2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EIESQIQKFM VQNRSASERN SSGDADSAHM EYPYGELIIS LGFFFVFFLE. It is sometimes possible for the material contained within the vial of "SLC39A2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.