Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (SLC37A4 antibody (MBS5301928) used at 1 ug/ml to detect target protein.)

Rabbit SLC37A4 Polyclonal Antibody | anti-SLC37A4 antibody

SLC37A4 antibody

Gene Names
SLC37A4; G6PT1; G6PT2; G6PT3; GSD1b; GSD1c; GSD1d; TRG19; TRG-19; PRO0685
Applications
Western Blot
Purity
Affinity purified
Synonyms
SLC37A4; Polyclonal Antibody; SLC37A4 antibody; Polyclonal SLC37A4; Anti-SLC37A4; GSD1c; GSD1b; GSD1d; G6PT3; Glucose-6-Phosphate Transporter 4; Solute Carrier Family 37 Member 4; SLCA4 37; TRG19; SLCA4-37; PRO0685; G6PT2; G6PT1; MGC15729; anti-SLC37A4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC37A4 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
429
Applicable Applications for anti-SLC37A4 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
SLC37A4 transports glucose-6-phosphate from the cytoplasm to the lumen of the endoplasmic reticulum. It forms with glucose-6-phosphatase the complex responsible for glucose production through glycogenolysis and gluconeogenesis. Hence, it plays a central role in homeostatic regulation of blood glucose levels.
Cross-Reactivity
Human
Immunogen
SLC37A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids VSFLCLLLIHNEPADVGLRNLDPMPSEGKKGSLKEESTLQELLLSPYLWV
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(SLC37A4 antibody (MBS5301928) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (SLC37A4 antibody (MBS5301928) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-SLC37A4 antibody
Rabbit polyclonal SLC37A4 antibody
Product Categories/Family for anti-SLC37A4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
46 kDa (MW of target protein)
NCBI Official Full Name
SLC37A4
NCBI Official Synonym Full Names
solute carrier family 37 (glucose-6-phosphate transporter), member 4
NCBI Official Symbol
SLC37A4
NCBI Official Synonym Symbols
G6PT1; G6PT2; G6PT3; GSD1b; GSD1c; GSD1d; TRG19; TRG-19; PRO0685
NCBI Protein Information
glucose-6-phosphate translocase
UniProt Protein Name
SLC37A4 protein
UniProt Gene Name
SLC37A4
UniProt Entry Name
Q6IBR9_HUMAN

NCBI Description

This gene regulates glucose-6-phosphate transport from the cytoplasm to the lumen of the endoplasmic reticulum, in order to maintain glucose homeostasis. It also plays a role in ATP-mediated calcium sequestration in the lumen of the endoplasmic reticulum. Mutations in this gene have been associated with various forms of glycogen storage disease. Alternative splicing in this gene results in multiple transcript variants.[provided by RefSeq, Aug 2009]

Uniprot Description

SLC37A4: Transports glucose-6-phosphate from the cytoplasm to the lumen of the endoplasmic reticulum. Forms with glucose-6- phosphatase the complex responsible for glucose production through glycogenolysis and gluconeogenesis. Hence, it plays a central role in homeostatic regulation of blood glucose levels. Defects in SLC37A4 are the cause of glycogen storage disease type 1B (GSD1B). GSD1B is a metabolic disorder characterized by impairment of terminal steps of glycogenolysis and gluconeogenesis. GSD1 patients manifest a wide range of clinical symptoms and biochemical abnormalities, including hypoglycemia, severe hepatomegaly due to excessive accumulation of glycogen, kidney enlargement, growth retardation, lactic acidemia, hyperlipidemia, and hyperuricemia. GSD1B patients also present a tendency towards infections associated with neutropenia, relapsing aphthous gingivostomatitis, and inflammatory bowel disease. Defects in SLC37A4 are the cause of glycogen storage disease type 1C (GSD1C). Defects in SLC37A4 are the cause of glycogen storage disease type 1D (GSD1D). Belongs to the major facilitator superfamily. Organophosphate:Pi antiporter (OPA) (TC 2.A.1.4) family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transporter, SLC family; Membrane protein, integral; Membrane protein, multi-pass; Transporter

Chromosomal Location of Human Ortholog: 11q23.3

Cellular Component: endoplasmic reticulum membrane; membrane; endoplasmic reticulum; integral to membrane; integral to endoplasmic reticulum membrane

Molecular Function: transporter activity; glucose-6-phosphate transmembrane transporter activity

Biological Process: transport; glucose-6-phosphate transport; hexose transport; carbohydrate metabolic process; glucose metabolic process; pathogenesis; glucose transport; glucose homeostasis; transmembrane transport

Disease: Glycogen Storage Disease Ic; Glycogen Storage Disease Ib

Research Articles on SLC37A4

Similar Products

Product Notes

The SLC37A4 slc37a4 (Catalog #AAA5301928) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SLC37A4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the SLC37A4 slc37a4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC37A4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.