Western Blot (WB)
(Western Blot analysis of SLC25A36 expression in transfected 293T cell line by SLC25A36 polyclonal antibody. Lane 1: SLC25A36 transfected lysate (34.32kD). Lane 2: Non-transfected lysate.)
Mouse anti-Human SLC25A36 Polyclonal Antibody | anti-SLC25A36 antibody
SLC25A36 (Solute Carrier Family 25, Member 36)
Gene Names
SLC25A36; PNC2
Reactivity
Human
Applications
Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
SLC25A36; Polyclonal Antibody; SLC25A36 (Solute Carrier Family 25; Member 36); Anti -SLC25A36 (Solute Carrier Family 25; anti-SLC25A36 antibody
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SLC25A36.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MSQRDTLVHLFAGGCGGTVGAILTCPLEVVKTRLQSSSVTLYISEVQLNTMAGASVNRVVSPGPLHCLKVILEKEGPRSLFRGLGPNLVGVAPSRAIYFAAYSNCKEKLNDVFDPDSTQVHMISAAMAGFTAITATNPIWLIKTRLQLDARNRGERRMGAFECVRKVYQTDGLKGFYRGMSASYAGISETVIHFVIYESIKQKLLEYKTASTMENDEESVKEASDFVGMMLAAATSKTCATTIAYPHEVVRTRLREEGTKYRSFFQTLSLLVQEEGYGSLYRGLTTHLVRQIPNTAIMMATYELVVYLLNG*
Applicable Applications for anti-SLC25A36 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human SLC25A36, aa1-312 (AAH14064).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of SLC25A36 expression in transfected 293T cell line by SLC25A36 polyclonal antibody. Lane 1: SLC25A36 transfected lysate (34.32kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of SLC25A36 expression in transfected 293T cell line by SLC25A36 polyclonal antibody. Lane 1: SLC25A36 transfected lysate (34.32kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-SLC25A36 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
34,283 Da
NCBI Official Full Name
solute carrier family 25 member 36 isoform b
NCBI Official Synonym Full Names
solute carrier family 25 (pyrimidine nucleotide carrier ), member 36
NCBI Official Symbol
SLC25A36
NCBI Official Synonym Symbols
PNC2
NCBI Protein Information
solute carrier family 25 member 36; solute carrier family 25, member 36
UniProt Protein Name
Solute carrier family 25 member 36
Protein Family
UniProt Gene Name
SLC25A36
UniProt Entry Name
S2536_HUMAN
Uniprot Description
SLC25A36: Belongs to the mitochondrial carrier family. 4 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, multi-pass; Transporter; Transporter, SLC family; Membrane protein, integral; Mitochondrial
Chromosomal Location of Human Ortholog: 3q23
Cellular Component: mitochondrion; mitochondrial inner membrane; integral to membrane
Molecular Function: pyrimidine nucleotide transmembrane transporter activity
Biological Process: mitochondrion organization and biogenesis; mitochondrial genome maintenance; regulation of mitochondrial membrane potential; pyrimidine nucleotide transport; transmembrane transport; response to estradiol stimulus
Research Articles on SLC25A36
Similar Products
Product Notes
The SLC25A36 slc25a36 (Catalog #AAA645274) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SLC25A36 (Solute Carrier Family 25, Member 36) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC25A36 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the SLC25A36 slc25a36 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSQRDTLVHL FAGGCGGTVG AILTCPLEVV KTRLQSSSVT LYISEVQLNT MAGASVNRVV SPGPLHCLKV ILEKEGPRSL FRGLGPNLVG VAPSRAIYFA AYSNCKEKLN DVFDPDSTQV HMISAAMAGF TAITATNPIW LIKTRLQLDA RNRGERRMGA FECVRKVYQT DGLKGFYRGM SASYAGISET VIHFVIYESI KQKLLEYKTA STMENDEESV KEASDFVGMM LAAATSKTCA TTIAYPHEVV RTRLREEGTK YRSFFQTLSL LVQEEGYGSL YRGLTTHLVR QIPNTAIMMA TYELVVYLLN G*. It is sometimes possible for the material contained within the vial of "SLC25A36, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
