Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit SLC25A18 Polyclonal Antibody | anti-SLC25A18 antibody

SLC25A18 Rabbit pAb

Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunofluorescence
Purity
Affinity purification
Synonyms
SLC25A18; Polyclonal Antibody; SLC25A18 Rabbit pAb; GC2; anti-SLC25A18 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
RRLLMEDGMQRNLKMEMLAGCGAGMCQVVVTCPMEMLKIQLQDAGRLAVHHQGSASAPSTSRSYTTGSASTHRRPSATLIAWELLRTQGLAGLYRGLGATLLRDIPFSIIYFPLFANLNNLGFNELAGKAS
Applicable Applications for anti-SLC25A18 antibody
Western Blot (WB), Immunofluorescence (IF)
Application Notes
WB: 1:500-1:2000
IF: 1:50-1:200
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 90-220 of human SLC25A18 (NP_113669.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
33,849 Da
NCBI Official Full Name
SLC25A18
UniProt Protein Name
Mitochondrial glutamate carrier 2
UniProt Gene Name
SLC25A18
UniProt Synonym Gene Names
GC2; GC-2
UniProt Entry Name
GHC2_HUMAN

Uniprot Description

Function: Involved in the transport of glutamate across the inner mitochondrial membrane. Glutamate is cotransported with H+. Ref.1

Subcellular location: Mitochondrion inner membrane; Multi-pass membrane protein

By similarity.

Sequence similarities: Belongs to the mitochondrial carrier (TC 2.A.29) family. [View classification]Contains 3 Solcar repeats.

Similar Products

Product Notes

The SLC25A18 slc25a18 (Catalog #AAA9143015) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC25A18 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SLC25A18 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF). WB: 1:500-1:2000 IF: 1:50-1:200. Researchers should empirically determine the suitability of the SLC25A18 slc25a18 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RRLLMEDGMQ RNLKMEMLAG CGAGMCQVVV TCPMEMLKIQ LQDAGRLAVH HQGSASAPST SRSYTTGSAS THRRPSATLI AWELLRTQGL AGLYRGLGAT LLRDIPFSII YFPLFANLNN LGFNELAGKA S. It is sometimes possible for the material contained within the vial of "SLC25A18, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.