Rabbit anti-Human, Mouse SLC25A13 Polyclonal Antibody | anti-SLC25A13 antibody

SLC25A13 (Calcium-binding Mitochondrial Carrier Protein Aralar2, Mitochondrial Aspartate Glutamate Carrier 2, Solute Carrier Family 25 Member 13, Citrin, ARALAR2) (MaxLight 550)

Cat. Num. AAA6394285

• Gene Names: SLC25A13; CTLN2; NICCD; CITRIN; ARALAR2
• Reactivity: Human, Mouse
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SLC25A13; Polyclonal Antibody; SLC25A13 (Calcium-binding Mitochondrial Carrier Protein Aralar2; Mitochondrial Aspartate Glutamate Carrier 2; Solute Carrier Family 25 Member 13; Citrin; ARALAR2) (MaxLight 550); anti-SLC25A13 antibody

• Host: Rabbit
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human SLC25A13. Species Crossreactivity: mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
• Sequence Length: 3150

• Applicable Applications for anti-SLC25A13 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full-length human SLC25A13, aa1-675 (NP_055066.1).
• Immunogen Sequence: MAAAKVALTKRADPAELRTIFLKYASIEKNGEFFMSPNDFVTRYLNIFGESQPNPKTVELLSGVVDQTKDGLISFQEFVAFESVLCAPDALFMVAFQLFDKAGKGEVTFEDVKQVFGQTTIHQHIPFNWDSEFVQLHFGKERKRHLTYAEFTQFLLEIQLEHAKQAFVQRDNARTGRVTAIDFRDIMVTIRPHVLTPFVEECLVAAAGGTTSHQVSFSYFNGFNSLLNNMELIRKIYSTLAGTRKDVEVTKEEFVLAAQKFGQVTPMEVDILFQLADLYEPRGRMTLADIERIAPLEEGTLPFNLAEAQRQKASGDSARPVLLQVAESAYRFGLGSVAGAVGATAVYPIDLVKTRMQNQRSTGSFVGELMYKNSFDCFKKVLRYEGFFGLYRGLLPQLLGVAPEKAIKLTVNDFVRDKFMHKDGSVPLAAEILAGGCAGGSQVIFTNPLEIVKIRLQVAGEITTGPRVSALSVVRDLGFFGIYKGAKACFLRDIPFSAIYFPCYAHVKASFANEDGQVSPGSLLLAGAIAGMPAASLVTPADVIKTRLQVAARAGQTTYSGVIDCFRKILREEGPKALWKGAGARVFRSSPQFGVTLLTYELLQRWFYIDFGGVKPMGSEPVPKSRINLPAPNPDHVGGYKLAVATFAGIENKFGLYLPLFKPSVSTSKAIGGGP
• Conjugate: MaxLight550
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Related Product Information for anti-SLC25A13 antibody

Catalyzes the calcium-dependent exchange of cytoplasmic glutamate with mitochondrial aspartate across the mitochondrial inner membrane. May have a function in the urea cycle.

Product Categories/Family for anti-SLC25A13 antibody

Antibodies; Ion Channel

NCBI and Uniprot Product Information

• NCBI GI #: 7657580
• NCBI GeneID: 10165
• NCBI Accession #: NM_014251.1
• NCBI GenBank Nucleotide #: NM_014251.1
• NCBI Official Full Name: Homo sapiens solute carrier family 25, member 13 (citrin) (SLC25A13), nuclear gene encoding mitochondrial protein, mRNA
• NCBI Official Synonym Full Names: solute carrier family 25 member 13
• NCBI Official Symbol: SLC25A13
• NCBI Official Synonym Symbols: CTLN2; NICCD; CITRIN; ARALAR2
• NCBI Protein Information: calcium-binding mitochondrial carrier protein Aralar2
• Protein Family: Calcium-binding mitochondrial carrier protein

NCBI Description

This gene is a member of the mitochondrial carrier family. The encoded protein contains four EF-hand Ca(2+) binding motifs in the N-terminal domain, and localizes to mitochondria. The protein catalyzes the exchange of aspartate for glutamate and a proton across the inner mitochondrial membrane, and is stimulated by calcium on the external side of the inner mitochondrial membrane. Mutations in this gene result in citrullinemia, type II. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2009]