Western Blot (WB)
(WB Suggested Anti-SLC23A2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: SH-SYSY cell lysate)
Rabbit SLC23A2 Polyclonal Antibody | anti-SLC23A2 antibody
SLC23A2 Antibody - middle region
Gene Names
SLC23A2; NBTL1; SVCT2; YSPL2; SLC23A1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SLC23A2; Polyclonal Antibody; SLC23A2 Antibody - middle region; anti-SLC23A2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range 100 ul at 0.5 - 1 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: VALIGLSGFQAAGERAGKHWGIAMLTIFLVLLFSQYARNVKFPLPIYKSK
Sequence Length
650
Applicable Applications for anti-SLC23A2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SLC23A2
Protein Interactions
AGPAT2; Nedd4; UBC
Protein Size (#AA)
650 amino acids
Blocking Peptide
For anti-SLC23A2 (MBS3207098) antibody is MBS3232064.
Replacement Item
This aantibody may replace item sc-30114 from Santa Cruz Biotechnology.
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-SLC23A2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: SH-SYSY cell lysate)
Western Blot (WB)
(WB Suggested Anti-SLC23A2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: SH-SYSY cell lysate)
Related Product Information for anti-SLC23A2 antibody
This is a rabbit polyclonal antibody against SLC23A2. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The absorption of vitamin C into the body and its distribution to organs requires two sodium-dependent vitamin C transporters. This gene encodes one of the two required transporters and the encoded protein accounts for tissue-specific uptake of vitamin C. Previously, this gene had an official symbol of SLC23A1.
Target Description: The absorption of vitamin C into the body and its distribution to organs requires two sodium-dependent vitamin C transporters. This gene encodes one of the two required transporters and the encoded protein accounts for tissue-specific uptake of vitamin C. Previously, this gene had an official symbol of SLC23A1.
Product Categories/Family for anti-SLC23A2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
70kDa
NCBI Official Full Name
solute carrier family 23 member 2
NCBI Official Synonym Full Names
solute carrier family 23 member 2
NCBI Official Symbol
SLC23A2
NCBI Official Synonym Symbols
NBTL1; SVCT2; YSPL2; SLC23A1
NCBI Protein Information
solute carrier family 23 member 2
UniProt Protein Name
Solute carrier family 23 member 2
Protein Family
UniProt Gene Name
SLC23A2
UniProt Synonym Gene Names
KIAA0238; NBTL1; SLC23A1; SVCT2; YSPL2; hSVCT2
NCBI Description
The absorption of vitamin C into the body and its distribution to organs requires two sodium-dependent vitamin C transporters. This gene encodes one of the two required transporters and the encoded protein accounts for tissue-specific uptake of vitamin C. Previously, this gene had an official symbol of SLC23A1. [provided by RefSeq, Jul 2008]
Research Articles on SLC23A2
Similar Products
Product Notes
The SLC23A2 slc23a2 (Catalog #AAA3207098) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC23A2 Antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SLC23A2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SLC23A2 slc23a2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VALIGLSGFQ AAGERAGKHW GIAMLTIFLV LLFSQYARNV KFPLPIYKSK. It is sometimes possible for the material contained within the vial of "SLC23A2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
