Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SLC20A1 Antibody Titration: 0.2-1 ug/mlPositive Control: MCF7 cell lysate)

Rabbit SLC20A1 Polyclonal Antibody | anti-SLC20A1 antibody

SLC20A1 antibody - C-terminal region

Gene Names
SLC20A1; PIT1; GLVR1; PiT-1; Glvr-1
Reactivity
Cow, Dog, Horse, Human, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SLC20A1; Polyclonal Antibody; SLC20A1 antibody - C-terminal region; anti-SLC20A1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LVALYLVYDTGDVSSKVATPIWLLLYGGVGICVGLWVWGRRVIQTMGKDL
Sequence Length
679
Applicable Applications for anti-SLC20A1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Pig: 100%; Rabbit: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human SLC20A1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SLC20A1 Antibody Titration: 0.2-1 ug/mlPositive Control: MCF7 cell lysate)

Western Blot (WB) (WB Suggested Anti-SLC20A1 Antibody Titration: 0.2-1 ug/mlPositive Control: MCF7 cell lysate)
Related Product Information for anti-SLC20A1 antibody
This is a rabbit polyclonal antibody against SLC20A1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Retrovirus receptors allow infection of human and murine cells by various retroviruses. The receptors that have been identified at the molecular level include CD4 (MIM 186940) for human immunodeficiency virus, Rec1 for murine ecotropic virus, and GLVR1 (SLC20A1) for gibbon ape leukemia virus. These 3 proteins show no homology to one another at the DNA or protein level. GLVR1 is a sodium-dependent phosphate symporter.Retrovirus receptors allow infection of human and murine cells by various retroviruses. The receptors that have been identified at the molecular level include CD4 (MIM 186940) for human immunodeficiency virus, Rec1 for murine ecotropic virus, and GLVR1 for gibbon ape leukemia virus (see MIM 182090). These 3 proteins show no homology to one another at the DNA or protein level. GLVR1 is a sodium-dependent phosphate symporter.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
74kDa
NCBI Official Full Name
sodium-dependent phosphate transporter 1
NCBI Official Synonym Full Names
solute carrier family 20 member 1
NCBI Official Symbol
SLC20A1
NCBI Official Synonym Symbols
PIT1; GLVR1; PiT-1; Glvr-1
NCBI Protein Information
sodium-dependent phosphate transporter 1
UniProt Protein Name
Sodium-dependent phosphate transporter 1
UniProt Gene Name
SLC20A1
UniProt Synonym Gene Names
GLVR1; PIT1; GLVR-1; PiT-1
UniProt Entry Name
S20A1_HUMAN

NCBI Description

The protein encoded by this gene is a sodium-phosphate symporter that absorbs phosphate from interstitial fluid for use in cellular functions such as metabolism, signal transduction, and nucleic acid and lipid synthesis. The encoded protein is also a retroviral receptor, causing human cells to be susceptible to infection by gibbon ape leukemia virus, simian sarcoma-associated virus, feline leukemia virus subgroup B, and 10A1 murine leukemia virus.[provided by RefSeq, Mar 2011]

Uniprot Description

SLC20A1: Sodium-phosphate symporter which plays a fundamental housekeeping role in phosphate transport, such as absorbing phosphate from interstitial fluid for normal cellular functions such as cellular metabolism, signal transduction, and nucleic acid and lipid synthesis. May play a role in extracellular matrix and cartilage calcification as well as in vascular calcification. May function as a retroviral receptor as it confers human cells susceptibility to infection to Gibbon Ape Leukemia Virus (GaLV), Simian sarcoma-associated virus (SSAV) and Feline leukemia virus subgroup B (FeLV-B) as well as 10A1 murine leukemia virus (10A1 MLV). Belongs to the inorganic phosphate transporter (PiT) (TC 2.A.20) family.

Protein type: Membrane protein, integral; Transporter, SLC family; Membrane protein, multi-pass; Transporter

Chromosomal Location of Human Ortholog: 2q13

Cellular Component: membrane; integral to plasma membrane; plasma membrane

Molecular Function: signal transducer activity; high affinity inorganic phosphate:sodium symporter activity; receptor activity; sodium:phosphate symporter activity; inorganic phosphate transmembrane transporter activity

Biological Process: positive regulation of I-kappaB kinase/NF-kappaB cascade; transport; ion transport; signal transduction; transmembrane transport; phosphate metabolic process

Research Articles on SLC20A1

Similar Products

Product Notes

The SLC20A1 slc20a1 (Catalog #AAA3207099) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC20A1 antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SLC20A1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SLC20A1 slc20a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LVALYLVYDT GDVSSKVATP IWLLLYGGVG ICVGLWVWGR RVIQTMGKDL. It is sometimes possible for the material contained within the vial of "SLC20A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.