Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SLC1A5Sample Tissue: Human 786-0 Whole CellAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human SLC1A5 Polyclonal Antibody | anti-SLC1A5 antibody

SLC1A5 Antibody - C-terminal region

Gene Names
SLC1A5; R16; AAAT; ATBO; M7V1; RDRC; ASCT2; M7VS1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
SLC1A5; Polyclonal Antibody; SLC1A5 Antibody - C-terminal region; anti-SLC1A5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DRSCTVLNVEGDALGAGLLQNYVDRTESRSTEPELIQVKSELPLDPLPVP
Sequence Length
167
Applicable Applications for anti-SLC1A5 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human SLC1A5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SLC1A5Sample Tissue: Human 786-0 Whole CellAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SLC1A5Sample Tissue: Human 786-0 Whole CellAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-SLC1A5 antibody
The SLC1A5 gene encodes a sodium-dependent neutral amino acid transporter that can act as a receptor for RD114/type D retrovirus (Larriba et al., 2001 [PubMed 11781704]).[supplied by OMIM, Jan 2011]
Product Categories/Family for anti-SLC1A5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57 kDa
NCBI Official Full Name
neutral amino acid transporter B(0) isoform 2
NCBI Official Synonym Full Names
solute carrier family 1 member 5
NCBI Official Symbol
SLC1A5
NCBI Official Synonym Symbols
R16; AAAT; ATBO; M7V1; RDRC; ASCT2; M7VS1
NCBI Protein Information
neutral amino acid transporter B(0)
UniProt Protein Name
Neutral amino acid transporter B(0)
UniProt Gene Name
SLC1A5
UniProt Synonym Gene Names
ASCT2; M7V1; RDR; RDRC; ATB(0)
UniProt Entry Name
AAAT_HUMAN

NCBI Description

The SLC1A5 gene encodes a sodium-dependent neutral amino acid transporter that can act as a receptor for RD114/type D retrovirus (Larriba et al., 2001 [PubMed 11781704]).[supplied by OMIM, Jan 2011]

Uniprot Description

SLC1A5: Has a broad substrate specificity, a preference for zwitterionic amino acids, and a sodium-dependence. It accepts as substrates all neutral amino acids, including glutamine, asparagine, and branched-chain and aromatic amino acids, and excludes methylated amino acids, anionic amino acids, and cationic amino acids. Act as a cell surface receptor for feline endogenous virus RD114, baboon M7 endogenous virus and type D simian retroviruses. Placenta, lung, skeletal muscle, kidney, pancreas, and intestine. Belongs to the sodium:dicarboxylate (SDF) symporter (TC 2.A.23) family. SLC1A5 subfamily. 1 isoforms of the human protein are produced by alternative initiation.

Protein type: Membrane protein, integral; Transporter; Transporter, SLC family; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 19q13.3

Cellular Component: Golgi apparatus; membrane; integral to plasma membrane; melanosome; plasma membrane

Molecular Function: viral receptor activity; L-serine transmembrane transporter activity; protein binding; neutral amino acid transmembrane transporter activity; receptor activity; L-glutamine transmembrane transporter activity; sodium:dicarboxylate symporter activity

Biological Process: neutral amino acid transport; extracellular amino acid transport; entry of virus into host cell; amino acid transport; dicarboxylic acid transport; ion transport; glutamine transport; transmembrane transport; L-serine transport

Research Articles on SLC1A5

Similar Products

Product Notes

The SLC1A5 slc1a5 (Catalog #AAA3220413) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC1A5 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC1A5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SLC1A5 slc1a5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DRSCTVLNVE GDALGAGLLQ NYVDRTESRS TEPELIQVKS ELPLDPLPVP. It is sometimes possible for the material contained within the vial of "SLC1A5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.