Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SLC1A1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysateSLC1A1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Rabbit SLC1A1 Polyclonal Antibody | anti-SLC1A1 antibody

SLC1A1 antibody - N-terminal region

Gene Names
SLC1A1; DCBXA; EAAC1; EAAT3; SCZD18
Reactivity
Cow, Dog, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SLC1A1; Polyclonal Antibody; SLC1A1 antibody - N-terminal region; anti-SLC1A1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VLVREHSNLSTLEKFYFAFPGEILMRMLKLIILPLIISSMITGVAALDSN
Sequence Length
524
Applicable Applications for anti-SLC1A1 antibody
Western Blot (WB)
Homology
Cow: 77%; Dog: 79%; Human: 100%; Mouse: 77%; Pig: 77%; Rabbit: 86%; Rat: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC1A1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SLC1A1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysateSLC1A1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Western Blot (WB) (WB Suggested Anti-SLC1A1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysateSLC1A1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)
Related Product Information for anti-SLC1A1 antibody
This is a rabbit polyclonal antibody against SLC1A1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SLC1A1 transports L-glutamate and also L- and D-aspartate. It is essential for terminating the postsynaptic action of glutamate by rapidly removing released glutamate from the synaptic cleft. SLC1A1 acts as a symport by cotransporting sodium. It negatively regulated by ARL6IP5.
Product Categories/Family for anti-SLC1A1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57kDa
NCBI Official Full Name
excitatory amino acid transporter 3
NCBI Official Synonym Full Names
solute carrier family 1 member 1
NCBI Official Symbol
SLC1A1
NCBI Official Synonym Symbols
DCBXA; EAAC1; EAAT3; SCZD18
NCBI Protein Information
excitatory amino acid transporter 3
UniProt Protein Name
Excitatory amino acid transporter 3
UniProt Gene Name
SLC1A1
UniProt Synonym Gene Names
EAAC1; EAAT3
UniProt Entry Name
EAA3_HUMAN

NCBI Description

This gene encodes a member of the high-affinity glutamate transporters that play an essential role in transporting glutamate across plasma membranes. In brain, these transporters are crucial in terminating the postsynaptic action of the neurotransmitter glutamate, and in maintaining extracellular glutamate concentrations below neurotoxic levels. This transporter also transports aspartate, and mutations in this gene are thought to cause dicarboxylicamino aciduria, also known as glutamate-aspartate transport defect. [provided by RefSeq, Mar 2010]

Research Articles on SLC1A1

Similar Products

Product Notes

The SLC1A1 slc1a1 (Catalog #AAA3207074) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC1A1 antibody - N-terminal region reacts with Cow, Dog, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SLC1A1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SLC1A1 slc1a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VLVREHSNLS TLEKFYFAFP GEILMRMLKL IILPLIISSM ITGVAALDSN. It is sometimes possible for the material contained within the vial of "SLC1A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.