Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (SLC19A1 antibody (MBS5300296) used at 5 ug/ml to detect target protein.)

Rabbit SLC19A1 Polyclonal Antibody | anti-SLC19A1 antibody

SLC19A1 antibody

Gene Names
SLC19A1; CHMD; FOLT; IFC1; REFC; RFC1
Applications
Western Blot, Immunohistochemistry
Purity
Total IgG Protein A purified
Synonyms
SLC19A1; Polyclonal Antibody; SLC19A1 antibody; Polyclonal SLC19A1; Anti-SLC19A1; SLCA1-19; RFC1; Solute Carrier Family 19 Member 1; FOLT; SLCA1 19; Folate Transporter 1; IFC1; CHMD; REFC; anti-SLC19A1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Purity/Purification
Total IgG Protein A purified
Form/Format
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SLC19A1 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
131
Applicable Applications for anti-SLC19A1 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
WB: 5 ug/ml
IHC: 4-8 ug/ml
Biological Significance
Transport of folate compounds into mammalian cells can occur via receptor-mediated or carrier-mediated mechanisms. A functional coordination between these 2 mechanisms has been proposed to be the method of folate uptake in certain cell types. Methotrexate (MTX) is an antifolate chemotherapeutic agent that is actively transported by the carrier-mediated uptake system. SLC19A1 plays a role in maintaining intracellular concentrations of folate.
Cross-Reactivity
Human
Immunogen
SLC19A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MVPSSPAVEKQVPVEPGPDPELRSWRHLVCYLCFYGFMAQIRPGESFITP
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(SLC19A1 antibody (MBS5300296) used at 5 ug/ml to detect target protein.)

Western Blot (WB) (SLC19A1 antibody (MBS5300296) used at 5 ug/ml to detect target protein.)
Related Product Information for anti-SLC19A1 antibody
Rabbit polyclonal SLC19A1 antibody
Product Categories/Family for anti-SLC19A1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
65 kDa (MW of target protein)
NCBI Official Full Name
SLC19A1 protein, partial
NCBI Official Synonym Full Names
solute carrier family 19 (folate transporter), member 1
NCBI Official Symbol
SLC19A1
NCBI Official Synonym Symbols
CHMD; FOLT; IFC1; REFC; RFC1
NCBI Protein Information
folate transporter 1
UniProt Protein Name
Folate transporter 1
UniProt Gene Name
SLC19A1
UniProt Synonym Gene Names
FLOT1; RFC1; FOLT; IFC-1; RFC
UniProt Entry Name
S19A1_HUMAN

NCBI Description

The membrane protein encoded by this gene is a transporter of folate and is involved in the regulation of intracellular concentrations of folate. Three transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Mar 2011]

Uniprot Description

SLC19A1: a transporter protein. Transports reduced folate, antitumor agents and folate antagonists such as methotrexate. Apparently involved in methotrexate resistance in various cancers and neural tube defects.

Protein type: Transporter; Membrane protein, multi-pass; Transporter, SLC family; Membrane protein, integral

Chromosomal Location of Human Ortholog: 21q22.3

Cellular Component: membrane; integral to plasma membrane; plasma membrane

Molecular Function: folic acid transporter activity; methotrexate transporter activity; folic acid binding

Biological Process: vitamin metabolic process; methotrexate transport; folic acid metabolic process; water-soluble vitamin metabolic process; folic acid transport

Research Articles on SLC19A1

Similar Products

Product Notes

The SLC19A1 slc19a1 (Catalog #AAA5300296) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SLC19A1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). WB: 5 ug/ml IHC: 4-8 ug/ml. Researchers should empirically determine the suitability of the SLC19A1 slc19a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC19A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.