Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (SLC18A2 (VMAT2) in human brain (cortex) was detected using HRP/DAB brown color stain)

Rabbit SLC18A2 Polyclonal Antibody | anti-SLC18A2 antibody

SLC18A2 antibody - N-terminal region

Gene Names
SLC18A2; SVAT; SVMT; VAT2; VMAT2; PKDYS2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
SLC18A2; Polyclonal Antibody; SLC18A2 antibody - N-terminal region; anti-SLC18A2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NATRDLTLHQTATQHMVTNASAVPSDCPSEDKDLLNENVQVGLLFASKAT
Sequence Length
514
Applicable Applications for anti-SLC18A2 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 86%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC18A2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(SLC18A2 (VMAT2) in human brain (cortex) was detected using HRP/DAB brown color stain)

Immunohistochemistry (IHC) (SLC18A2 (VMAT2) in human brain (cortex) was detected using HRP/DAB brown color stain)
Related Product Information for anti-SLC18A2 antibody
This is a rabbit polyclonal antibody against SLC18A2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The vesicular monoamine transporter acts to accumulate cytosolic monoamines into synaptic vesicles, using the proton gradient maintained across the synaptic vesicular membrane. Its proper function is essential to the correct activity of the monoaminergic systems that have been implicated in several human neuropsychiatric disorders. The transporter is a site of action of important drugs, including reserpine and tetrabenazine.
Product Categories/Family for anti-SLC18A2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
synaptic vesicular amine transporter
NCBI Official Synonym Full Names
solute carrier family 18 member A2
NCBI Official Symbol
SLC18A2
NCBI Official Synonym Symbols
SVAT; SVMT; VAT2; VMAT2; PKDYS2
NCBI Protein Information
synaptic vesicular amine transporter
UniProt Protein Name
Synaptic vesicular amine transporter
UniProt Gene Name
SLC18A2
UniProt Synonym Gene Names
SVMT; VMAT2; VAT2
UniProt Entry Name
VMAT2_HUMAN

NCBI Description

This gene encodes an transmembrane protein that functions as an ATP-dependent transporter of monoamines, such as dopamine, norepinephrine, serotonin, and histamine. This protein transports amine neurotransmitters into synaptic vesicles. Polymorphisms in this gene may be associated with schizophrenia, bipolar disorder, and other neurological/psychiatric ailments. [provided by RefSeq, Jun 2018]

Uniprot Description

SLC18A2: Involved in the ATP-dependent vesicular transport of biogenic amine neurotransmitters. Pumps cytosolic monoamines including dopamine, norepinephrine, serotonin, and histamine into synaptic vesicles. Requisite for vesicular amine storage prior to secretion via exocytosis. Belongs to the major facilitator superfamily. Vesicular transporter family.

Protein type: Transporter; Transporter, SLC family; Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 10q25

Cellular Component: synaptic vesicle; synaptic vesicle membrane; membrane; cell soma; integral to plasma membrane; plasma membrane; terminal button

Molecular Function: serotonin transmembrane transporter activity; enzyme binding; amine transmembrane transporter activity; heat shock protein binding; monoamine transmembrane transporter activity; drug binding

Biological Process: dopamine transport; neurotransmitter secretion; death; amine transport; response to amphetamine; monoamine transport; locomotory behavior; response to herbicide; glucose homeostasis; endocytic recycling; response to cocaine; sequestering of neurotransmitter; post-embryonic development; response to starvation; synaptic transmission; insulin secretion; response to zinc ion; serotonin transport; transmembrane transport; negative regulation of neurotransmitter transport; aging; response to corticosterone stimulus

Research Articles on SLC18A2

Similar Products

Product Notes

The SLC18A2 slc18a2 (Catalog #AAA3207063) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC18A2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SLC18A2 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the SLC18A2 slc18a2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NATRDLTLHQ TATQHMVTNA SAVPSDCPSE DKDLLNENVQ VGLLFASKAT. It is sometimes possible for the material contained within the vial of "SLC18A2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.