Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SLC16A7Sample Type: Fetal Heart lysatesAntibody Dilution: 1.0ug/ml)

Rabbit SLC16A7 Polyclonal Antibody | anti-SLC16A7 antibody

SLC16A7 Antibody - C-terminal region

Gene Names
SLC16A7; MCT2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SLC16A7; Polyclonal Antibody; SLC16A7 Antibody - C-terminal region; anti-SLC16A7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LAGKLVDLTGEYKYMYMSCGAIVVAASVWLLIGNAINYRLLAKERKEENA
Sequence Length
379
Applicable Applications for anti-SLC16A7 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 86%; Guinea Pig: 75%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 79%; Rabbit: 85%; Rat: 79%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of human SLC16A7
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SLC16A7Sample Type: Fetal Heart lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SLC16A7Sample Type: Fetal Heart lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-SLC16A7 antibody
This is a rabbit polyclonal antibody against SLC16A7. It was validated on Western Blot

Target Description: This gene is a member of the monocarboxylate transporter family. Members in this family transport metabolites, such as lactate, pyruvate, and ketone bodies. The protein encoded by this gene catalyzes the proton-linked transport of monocarboxylates and has the highest affinity for pyruvate. This protein has been reported to be more highly expressed in prostate and colorectal cancer specimens when compared to control specimens. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-SLC16A7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
monocarboxylate transporter 2
NCBI Official Synonym Full Names
solute carrier family 16 member 7
NCBI Official Symbol
SLC16A7
NCBI Official Synonym Symbols
MCT2
NCBI Protein Information
monocarboxylate transporter 2
UniProt Protein Name
Monocarboxylate transporter 2
UniProt Gene Name
SLC16A7
UniProt Synonym Gene Names
MCT2; MCT 2
UniProt Entry Name
MOT2_HUMAN

NCBI Description

This gene is a member of the monocarboxylate transporter family. Members in this family transport metabolites, such as lactate, pyruvate, and ketone bodies. The protein encoded by this gene catalyzes the proton-linked transport of monocarboxylates and has the highest affinity for pyruvate. This protein has been reported to be more highly expressed in prostate and colorectal cancer specimens when compared to control specimens. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2012]

Uniprot Description

SLC16A7: Proton-linked monocarboxylate transporter. Catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate. MCT2 is a high affinity pyruvate transporter. Belongs to the major facilitator superfamily. Monocarboxylate porter (TC 2.A.1.13) family.

Protein type: Membrane protein, multi-pass; Transporter, SLC family; Transporter; Membrane protein, integral

Chromosomal Location of Human Ortholog: 12q13

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: pyruvate secondary active transmembrane transporter activity; symporter activity; lactate transmembrane transporter activity; secondary active monocarboxylate transmembrane transporter activity; pyruvate transmembrane transporter activity

Biological Process: transmembrane transport

Research Articles on SLC16A7

Similar Products

Product Notes

The SLC16A7 slc16a7 (Catalog #AAA3207087) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC16A7 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SLC16A7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SLC16A7 slc16a7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LAGKLVDLTG EYKYMYMSCG AIVVAASVWL LIGNAINYRL LAKERKEENA. It is sometimes possible for the material contained within the vial of "SLC16A7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.