Immunohistochemistry (IHC)
(Sample Type: Human Small intestineAnti-SLC13A2 antibody IHC of human small intestine. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. SLC13A2 Antibody concentration 5 ug/ml.)
Rabbit SLC13A2 Polyclonal Antibody | anti-SLC13A2 antibody
SLC13A2 antibody - middle region
Gene Names
SLC13A2; NaCT; NADC1; SDCT1; NaDC-1
Reactivity
Cow, Dog, Guinea Pig, Human, Pig, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
SLC13A2; Polyclonal Antibody; SLC13A2 antibody - middle region; anti-SLC13A2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PNAKGESMVSDGTVAIFIGIIMFIIPSKFPGLTQDPENPGKLKAPLGLLD
Sequence Length
592
Applicable Applications for anti-SLC13A2 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 79%; Dog: 77%; Guinea Pig: 75%; Human: 100%; Pig: 79%; Rabbit: 85%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SLC13A2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Sample Type: Human Small intestineAnti-SLC13A2 antibody IHC of human small intestine. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. SLC13A2 Antibody concentration 5 ug/ml.)
Immunohistochemistry (IHC)
(Sample Type: Human Small intestineAnti-SLC13A2 antibody IHC of human small intestine. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. SLC13A2 Antibody concentration 5 ug/ml.)
Western Blot (WB)
(WB Suggested Anti-SLC13A2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 721_B cell lysate)
Western Blot (WB)
(WB Suggested Anti-SLC13A2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 721_B cell lysate)
Related Product Information for anti-SLC13A2 antibody
This is a rabbit polyclonal antibody against SLC13A2. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: SLC13A2 belongs to the SLC13A transporter (TC 2.A.47) family, NADC subfamily. It is a multi-pass membrane protein. SLC13A2 cotransports of sodium ions and dicarboxylates such as succinate and citrate.
Target Description: SLC13A2 belongs to the SLC13A transporter (TC 2.A.47) family, NADC subfamily. It is a multi-pass membrane protein. SLC13A2 cotransports of sodium ions and dicarboxylates such as succinate and citrate.
Product Categories/Family for anti-SLC13A2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64kDa
NCBI Official Full Name
solute carrier family 13 member 2 isoform b
NCBI Official Synonym Full Names
solute carrier family 13 member 2
NCBI Official Symbol
SLC13A2
NCBI Official Synonym Symbols
NaCT; NADC1; SDCT1; NaDC-1
NCBI Protein Information
solute carrier family 13 member 2
UniProt Protein Name
Solute carrier family 13 member 2
Protein Family
UniProt Gene Name
SLC13A2
UniProt Synonym Gene Names
NADC1; SDCT1; NaDC-1
UniProt Entry Name
S13A2_HUMAN
NCBI Description
The protein encoded by this gene is a sodium-coupled citrate transporter that is regulated by the chaperone activity of cyclophilin b. The encoded protein may play a role in the formation of kidney stones. [provided by RefSeq, Oct 2016]
Research Articles on SLC13A2
Similar Products
Product Notes
The SLC13A2 slc13a2 (Catalog #AAA3207073) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC13A2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Human, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SLC13A2 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the SLC13A2 slc13a2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PNAKGESMVS DGTVAIFIGI IMFIIPSKFP GLTQDPENPG KLKAPLGLLD. It is sometimes possible for the material contained within the vial of "SLC13A2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
