Western Blot (WB)
(WB Suggested Anti-NKAIN4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: MCF7 cell lysate)
Rabbit NKAIN4 Polyclonal Antibody | anti-NKAIN4 antibody
NKAIN4 antibody - middle region
Gene Names
NKAIN4; FAM77A; C20orf58; bA261N11.2
Reactivity
Dog, Guinea Pig, Human, Mouse, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NKAIN4; Polyclonal Antibody; NKAIN4 antibody - middle region; anti-NKAIN4 antibody
Host
Rabbit
Reactivity
Dog, Guinea Pig, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LLGFVCGCQVVSVFTDEEDSFDFIGGFDPFPLYHVNEKPSSLLSKQVYLP
Sequence Length
208
Applicable Applications for anti-NKAIN4 antibody
Western Blot (WB)
Homology
Dog: 79%; Guinea Pig: 79%; Human: 100%; Mouse: 100%; Rat: 93%; Zebrafish: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human NKAIN4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-NKAIN4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: MCF7 cell lysate)
Western Blot (WB)
(WB Suggested Anti-NKAIN4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: MCF7 cell lysate)
Related Product Information for anti-NKAIN4 antibody
This is a rabbit polyclonal antibody against NKAIN4. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The specific function of NKAIN4 is not yet known.
Target Description: The specific function of NKAIN4 is not yet known.
Product Categories/Family for anti-NKAIN4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
sodium/potassium-transporting ATPase subunit beta-1-interacting protein 4 isoform 1
NCBI Official Synonym Full Names
sodium/potassium transporting ATPase interacting 4
NCBI Official Symbol
NKAIN4
NCBI Official Synonym Symbols
FAM77A; C20orf58; bA261N11.2
NCBI Protein Information
sodium/potassium-transporting ATPase subunit beta-1-interacting protein 4
UniProt Protein Name
Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 4
UniProt Gene Name
NKAIN4
UniProt Synonym Gene Names
C20orf58; FAM77A; Na(+)/K(+)-transporting ATPase subunit beta-1-interacting protein 4
UniProt Entry Name
NKAI4_HUMAN
NCBI Description
NKAIN4 is a member of a family of mammalian proteins (see NKAIN1; MIM 612871) with similarity to Drosophila Nkain and interacts with the beta subunit of Na,K-ATPase (ATP1B1; MIM 182330) (Gorokhova et al., 2007 [PubMed 17606467]).[supplied by OMIM, Jun 2009]
Similar Products
Product Notes
The NKAIN4 nkain4 (Catalog #AAA3211140) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NKAIN4 antibody - middle region reacts with Dog, Guinea Pig, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's NKAIN4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NKAIN4 nkain4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LLGFVCGCQV VSVFTDEEDS FDFIGGFDPF PLYHVNEKPS SLLSKQVYLP. It is sometimes possible for the material contained within the vial of "NKAIN4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
